|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3VZ9) |
Sites (0, 0)| (no "Site" information available for 3VZ9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3VZ9) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3VZ9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3VZ9) |
Exons (0, 0)| (no "Exon" information available for 3VZ9) |
Sequences/Alignments
Asymmetric/Biological UnitChain B from PDB Type:PROTEIN Length:103 aligned with E1C4Y2_CHICK | E1C4Y2 from UniProtKB/TrEMBL Length:234 Alignment length:103 140 150 160 170 180 190 200 210 220 230 E1C4Y2_CHICK 131 TKERVERLCKSKELFEERLGLEIRRIHNEQLQFIFRHIDHKDPDKPYMFTLSINEQGDYEVTSCTPPLDCISEFQLKVRETNNFSAFIANIRKAFTALSFKQS 233 SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 3vz9 B 131 TKERVERLCKSKELFEERLGLEIRRIHNEQLQFIFRHIDHKDPDKPYMFTLSINEQGDYEVTSCTPPLDCISEFQLKVRETNNFSAFIANIRKAFTALSFKQS 233 140 150 160 170 180 190 200 210 220 230 Chain D from PDB Type:PROTEIN Length:60 aligned with R4GRT3_CHICK | R4GRT3 from UniProtKB/TrEMBL Length:73 Alignment length:60 23 33 43 53 63 73 R4GRT3_CHICK 14 YVTQLYYKISRIDWDYEVEPARIKGIHYGPDIAQPINMDSSHHSRCFISDYLWSLVPTAW 73 SCOP domains ------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------ Transcript 3vz9 D 136 YVTQLYYKISRIDWDYEVEPARIKGIHYGPDIAQPINMDSSHHSRCFISDYLWSLVPTAW 195 145 155 165 175 185 195
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3VZ9) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3VZ9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3VZ9) |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain B (E1C4Y2_CHICK | E1C4Y2)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|