3TKY - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   MONOLIGNOL O-METHYLTRANSFERASE (MOMT)

Authors :   M. W. Bhuiya, C. J. Liu

Date :   29 Aug 11 (Deposition) - 29 Aug 12 (Release) - 05 Sep 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.47

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Directed Evolution, Saturation Mutagenesis, Regioselectivity, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Zhang, M. W. Bhuiya, J. R. Pazo, Y. Miao, H. Kim, J. Ralph, C. J. Liu
An Engineered Monolignol 4-O-Methyltransferase Depresses Lignin Biosynthesis And Confers Novel Metabolic Capability In Arabidopsis.
Plant Cell V. 24 3135 2012
PubMed-ID: 22851762 | Reference-DOI: 10.1105/TPC.112.101287

Molecule 1 - (ISO)EUGENOL O-METHYLTRANSFERASE
	Chains	:	A, B, C, D
	EC Number	:	2.1.1.146
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-28B
	Expression System Strain	:	BL-21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	IEMT1
	Mutation	:	YES
	Organism Common	:	FARIY FANS
	Organism Scientific	:	CLARKIA BREWERI
	Organism Taxid	:	36903

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 8)

No.	Name	Count	Type	Full Name
1	N7I	4	Ligand/Ion	4-[(1E)-3-HYDROXYPROP-1-EN-1-YL]-2-METHOXYPHENOL
2	SAH	4	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 1 (2, 4)

No.	Name	Count	Type	Full Name
1	N7I	2	Ligand/Ion	4-[(1E)-3-HYDROXYPROP-1-EN-1-YL]-2-METHOXYPHENOL
2	SAH	2	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	N7I	2	Ligand/Ion	4-[(1E)-3-HYDROXYPROP-1-EN-1-YL]-2-METHOXYPHENOL
2	SAH	2	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:165 , PHE A:166 , PHE A:179 , ASP A:273 , MET A:323 , TYR A:326 , ASN A:327 , PRO A:328	BINDING SITE FOR RESIDUE N7I A 369
2	AC2	SOFTWARE	PHE A:166 , SER A:187 , GLY A:211 , GLY A:212 , GLY A:213 , ASP A:234 , LEU A:235 , VAL A:238 , ASP A:254 , MET A:255 , PHE A:256 , LYS A:268 , TRP A:269 , ILE A:270 , ASP A:273 , TRP A:274 , HOH A:388	BINDING SITE FOR RESIDUE SAH A 370
3	AC3	SOFTWARE	SER A:30 , PHE B:130 , ALA B:134 , LEU B:139 , ILE B:165 , PHE B:179 , MET B:183 , ASP B:273 , LEU B:322 , ASN B:327	BINDING SITE FOR RESIDUE N7I B 369
4	AC4	SOFTWARE	PHE B:166 , PHE B:179 , SER B:187 , GLY B:211 , GLY B:212 , ASP B:234 , LEU B:235 , GLY B:253 , ASP B:254 , MET B:255 , PHE B:256 , LYS B:268 , ILE B:270 , ASP B:273 , TRP B:274 , HOH B:382	BINDING SITE FOR RESIDUE SAH B 370
5	AC5	SOFTWARE	ALA C:134 , LEU C:139 , ILE C:165 , PHE C:179 , MET C:183 , TRP C:269 , HIS C:272 , ASP C:273 , LEU C:322 , MET C:323 , ASN C:327 , SAH C:370	BINDING SITE FOR RESIDUE N7I C 369
6	AC6	SOFTWARE	PHE C:166 , MET C:183 , SER C:187 , GLY C:211 , GLY C:212 , ASP C:234 , LEU C:235 , VAL C:238 , GLY C:253 , ASP C:254 , MET C:255 , LYS C:268 , ILE C:270 , N7I C:369 , HOH C:377 , HOH C:384 , HOH C:406	BINDING SITE FOR RESIDUE SAH C 370
7	AC7	SOFTWARE	PHE D:130 , LEU D:133 , LEU D:139 , PHE D:179 , TRP D:269 , THR D:319 , LEU D:322 , ASN D:327	BINDING SITE FOR RESIDUE N7I D 369
8	AC8	SOFTWARE	PHE D:166 , PHE D:179 , SER D:187 , GLY D:211 , GLY D:212 , GLY D:213 , ASP D:234 , LEU D:235 , VAL D:238 , ASP D:254 , MET D:255 , PHE D:256 , LYS D:268 , ILE D:270 , ASP D:273 , TRP D:274 , HOH D:381 , HOH D:387	BINDING SITE FOR RESIDUE SAH D 370

(no "SS Bond" information available for 3TKY)

(no "Cis Peptide Bond" information available for 3TKY)

(no "SAP(SNP)/Variant" information available for 3TKY)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_OMT_II	PS51683	SAM-dependent O-methyltransferase class II-type profile.	IEMT_CLABR	26-366	4	A:26-366 B:26-366 C:26-366 D:26-366

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_OMT_II	PS51683	SAM-dependent O-methyltransferase class II-type profile.	IEMT_CLABR	26-366	2	A:26-366 B:26-366 - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_OMT_II	PS51683	SAM-dependent O-methyltransferase class II-type profile.	IEMT_CLABR	26-366	2	- - C:26-366 D:26-366

(no "Exon" information available for 3TKY)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:352
 aligned with IEMT_CLABR | O04385 from UniProtKB/Swiss-Prot  Length:368

    Alignment length:352
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365  
           IEMT_CLABR    16 SSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLTATDKVLLEPWFYLKDAILEGGIPFNKAYGMNEFDYHGTDHRFNKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
               SCOP domains d3tkya1 A:16-122 automated matches                                                                         d3tkya2 A:123-367 automated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhhhhhh.......hhhhhhh.......hhhhhhhhhhhhhhh...eeeeeee.....eeeeeee..hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhhh...eeeeeehhhhhh.......eeeee...........eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeee.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhh...eeeeeeee..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------SAM_OMT_II  PDB: A:26-366 UniProt: 26-366                                                                                                                                                                                                                                                                                                            - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3tky A  16 SSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLLATDKVLLEPWFYLKDAILEGGIPFNKAYGMNIFDYHGTDHRINKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365

Chain B from PDB  Type:PROTEIN  Length:349
 aligned with IEMT_CLABR | O04385 from UniProtKB/Swiss-Prot  Length:368

    Alignment length:359
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358         
           IEMT_CLABR     9 IQIIPTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLTATDKVLLEPWFYLKDAILEGGIPFNKAYGMNEFDYHGTDHRFNKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
               SCOP domains d3tkyb1 B:9-122 automated matches                                                                                 d3tkyb2 B:123-367 automated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..---...hhhhhhh.......hhhhhhhhhhhhhhhh..eeee..-------..eeee.hhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhhh...eeeeeehhhhhh.......eeeee...........eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeee.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....eeeeeeee..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------SAM_OMT_II  PDB: B:26-366 UniProt: 26-366                                                                                                                                                                                                                                                                                                            - PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3tky B   9 IQIIPTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSV---GYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLR-------ERLYGLAPVCKFLTKNEDGVSLAPFLLLATDKVLLEPWFYLKDAILEGGIPFNKAYGMNIFDYHGTDHRINKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
                                    18        28        38        48     |  58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358         
                                                                        54  58                                      98     106

Chain C from PDB  Type:PROTEIN  Length:352
 aligned with IEMT_CLABR | O04385 from UniProtKB/Swiss-Prot  Length:368

    Alignment length:352
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365  
           IEMT_CLABR    16 SSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLTATDKVLLEPWFYLKDAILEGGIPFNKAYGMNEFDYHGTDHRFNKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
               SCOP domains d3tkyc1 C:16-122 automated matches                                                                         d3tkyc2 C:123-367 automated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhh......hhhhhhhhhhhhhhhh..eeeeeee.....eeeeeee..hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhhh...eeeeeehhhhhh.......eeeee...........eeeee......hhhhhhhhhhhhhhh.....eeeeee.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhh...eeeeeeee..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------SAM_OMT_II  PDB: C:26-366 UniProt: 26-366                                                                                                                                                                                                                                                                                                            - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3tky C  16 SSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLLATDKVLLEPWFYLKDAILEGGIPFNKAYGMNIFDYHGTDHRINKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365

Chain D from PDB  Type:PROTEIN  Length:348
 aligned with IEMT_CLABR | O04385 from UniProtKB/Swiss-Prot  Length:368

    Alignment length:359
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358         
           IEMT_CLABR     9 IQIIPTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLTATDKVLLEPWFYLKDAILEGGIPFNKAYGMNEFDYHGTDHRFNKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
               SCOP domains d3tkyd1 D:9-122 automated matches                                                                                 d3tkyd2 D:123-367 automated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh----...hhhhhhh.......hhhhhhhhhhhhhhhh..eeee..-------..eeee.hhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeee....hhhhhhhhhhh...eeeee.hhhhhhh......eee.............eeeee.hhhhhhhhhhhhhhhhhhhh.....eeeeee.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhh...eeeeeeee..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------SAM_OMT_II  PDB: D:26-366 UniProt: 26-366                                                                                                                                                                                                                                                                                                            - PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3tky D   9 IQIIPTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKS----GYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLR-------ERLYGLAPVCKFLTKNEDGVSLAPFLLLATDKVLLEPWFYLKDAILEGGIPFNKAYGMNIFDYHGTDHRINKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLKT 367
                                    18        28        38        48    |   58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358         
                                                                       53   58                                      98     106

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: DNA/RNA-binding 3-helical bundle (1299)

Superfamily: Winged helix DNA-binding domain (576)

Family: automated matches (118)

Protein domain: automated matches (118)

Clarkia breweri [TaxId: 36903] (2)

1a	d3tkya1	A:16-122
1b	d3tkyb1	B:9-122
1c	d3tkyc1	C:16-122
1d	d3tkyd1	D:9-122

Class: Alpha and beta proteins (a/b) (23833)

Fold: S-adenosyl-L-methionine-dependent methyltransferases (533)

Superfamily: S-adenosyl-L-methionine-dependent methyltransferases (533)

Family: Plant O-methyltransferase, C-terminal domain (15)

Protein domain: automated matches (3)

Clarkia breweri [TaxId: 36903] (2)

2a	d3tkya2	A:123-367
2b	d3tkyb2	B:123-367
2c	d3tkyc2	C:123-367
2d	d3tkyd2	D:123-367

(no "CATH Domain" information available for 3TKY)

(no "Pfam Domain" information available for 3TKY)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (IEMT_CLABR | O04385)

molecular function
	GO:0050630	(iso)eugenol O-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine + isoeugenol = S-adenosyl-L-homocysteine + isomethyleugenol.
	GO:0008171	O-methyltransferase activity	Catalysis of the transfer of a methyl group to the oxygen atom of an acceptor molecule.
	GO:0008168	methyltransferase activity	Catalysis of the transfer of a methyl group to an acceptor molecule.
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0032259	methylation	The process in which a methyl group is covalently attached to a molecule.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		N7I	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SAH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3tky)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3tky
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IEMT_CLABR \| O04385
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.1.146
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IEMT_CLABR \| O04385
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IEMT_CLABR \| O04385	:	3reo 5cvj 5cvu 5cvv

(no "Related Entries Specified in the PDB File" available for 3TKY)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File