3TJM - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE HUMAN FATTY ACID SYNTHASE THIOESTERASE DOMAIN WITH AN ACTIVATE SITE-SPECIFIC POLYUNSATURATED FATTY ACYL ADDUCT

Authors :   W. Zhang, F. Zheng, A. Q. Florante

Date :   24 Aug 11 (Deposition) - 28 Sep 11 (Release) - 16 Nov 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.48

Chains :   Asym./Biol. Unit : A

Keywords :   Thioesterase Domain, Fatty Acid Synthesis, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. Zhang, B. Chakravarty, F. Zheng, Z. Gu, H. Wu, J. Mao, S. J. Wakil, F. A. Quiocho
Crystal Structure Of Fas Thioesterase Domain With Polyunsaturated Fatty Acyl Adduct And Inhibition By Dihomo-Gamma-Linolenic Acid.
Proc. Natl. Acad. Sci. Usa V. 108 15757 2011
PubMed-ID: 21908709 | Reference-DOI: 10.1073/PNAS.1112334108

Molecule 1 - FATTY ACID SYNTHASE
	Chains	:	A
	EC Number	:	2.3.1.85, 2.3.1.38, 2.3.1.39, 2.3.1.41, 1.1.1.100, 4.2.1.61, 1.3.1.10, 3.1.2.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PROEX
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 2218-2500
	Gene	:	FAS, FASN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	[ACYL-CARRIER-PROTEIN] S-ACETYLTRANSFERASE, [ACYL-CARRIER- PROTEIN] S-MALONYLTRANSFERASE, 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE, 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE, 3- HYDROXYPALMITOYL-[ACYL-CARRIER-PROTEIN] DEHYDRATASE, ENOYL-[ACYL- CARRIER-PROTEIN] REDUCTASE, OLEOYL-[ACYL-CARRIER-PROTEIN] HYDROLASE

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 1)

No.	Name	Count	Type	Full Name
1	7FA	1	Ligand/Ion	METHYL (S)-(6Z,9Z)-OCTADECA-6,9,12-TRIEN-1-YLPHOSPHONOFLUORIDATE

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PRO A:2249 , ILE A:2250 , GLU A:2251 , SER A:2308 , TYR A:2309 , TYR A:2347 , TYR A:2351 , PHE A:2370 , LEU A:2427 , ARG A:2428 , GLU A:2431	BINDING SITE FOR RESIDUE 7FA A 500

(no "SS Bond" information available for 3TJM)

Asymmetric/Biological Unit

No.	Residues
1	Gly A:2300	-	Pro A:2301
2	Ser A:2326	-	Pro A:2327

(no "SAP(SNP)/Variant" information available for 3TJM)

(no "PROSITE Motif" information available for 3TJM)

Asymmetric/Biological Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000306749	1	ENSE00001379760	chr17:80056106-80055997	110	FAS_HUMAN	-	0	0	-	-
1.2	ENST00000306749	2	ENSE00001188368	chr17:80054328-80054195	134	FAS_HUMAN	1-43	43	0	-	-
1.3	ENST00000306749	3	ENSE00001163495	chr17:80053348-80053196	153	FAS_HUMAN	43-94	52	0	-	-
1.4	ENST00000306749	4	ENSE00001163489	chr17:80051647-80051474	174	FAS_HUMAN	94-152	59	0	-	-
1.5	ENST00000306749	5	ENSE00001163482	chr17:80051295-80051095	201	FAS_HUMAN	152-219	68	0	-	-
1.6	ENST00000306749	6	ENSE00001163474	chr17:80050895-80050773	123	FAS_HUMAN	219-260	42	0	-	-
1.7	ENST00000306749	7	ENSE00001163463	chr17:80050688-80050573	116	FAS_HUMAN	260-298	39	0	-	-
1.8	ENST00000306749	8	ENSE00001163453	chr17:80050465-80050331	135	FAS_HUMAN	299-343	45	0	-	-
1.9	ENST00000306749	9	ENSE00001163444	chr17:80049560-80049098	463	FAS_HUMAN	344-498	155	0	-	-
1.10	ENST00000306749	10	ENSE00001163437	chr17:80048945-80048758	188	FAS_HUMAN	498-560	63	0	-	-
1.11	ENST00000306749	11	ENSE00001163429	chr17:80048440-80048251	190	FAS_HUMAN	561-624	64	0	-	-
1.12	ENST00000306749	12	ENSE00001163421	chr17:80047602-80047508	95	FAS_HUMAN	624-655	32	0	-	-
1.13	ENST00000306749	13	ENSE00001163412	chr17:80047260-80047126	135	FAS_HUMAN	656-700	45	0	-	-
1.14	ENST00000306749	14	ENSE00001163403	chr17:80047048-80046845	204	FAS_HUMAN	701-768	68	0	-	-
1.15	ENST00000306749	15	ENSE00001163393	chr17:80046752-80046637	116	FAS_HUMAN	769-807	39	0	-	-
1.16	ENST00000306749	16	ENSE00001163385	chr17:80046438-80046266	173	FAS_HUMAN	807-865	59	0	-	-
1.17	ENST00000306749	17	ENSE00001163378	chr17:80046183-80045992	192	FAS_HUMAN	865-929	65	0	-	-
1.18	ENST00000306749	18	ENSE00001163370	chr17:80045910-80045830	81	FAS_HUMAN	929-956	28	0	-	-
1.19	ENST00000306749	19	ENSE00001163364	chr17:80045737-80045561	177	FAS_HUMAN	956-1015	60	0	-	-
1.20	ENST00000306749	20	ENSE00001163353	chr17:80045380-80045201	180	FAS_HUMAN	1015-1075	61	0	-	-
1.21	ENST00000306749	21	ENSE00001163343	chr17:80045129-80044926	204	FAS_HUMAN	1075-1143	69	0	-	-
1.22	ENST00000306749	22	ENSE00001163338	chr17:80044434-80044130	305	FAS_HUMAN	1143-1244	102	0	-	-
1.23	ENST00000306749	23	ENSE00001163334	chr17:80043747-80043358	390	FAS_HUMAN	1245-1374	130	0	-	-
1.24	ENST00000306749	24	ENSE00001163328	chr17:80043278-80043114	165	FAS_HUMAN	1375-1429	55	0	-	-
1.25	ENST00000306749	25	ENSE00001163322	chr17:80043032-80042911	122	FAS_HUMAN	1430-1470	41	0	-	-
1.26	ENST00000306749	26	ENSE00001163317	chr17:80042829-80042675	155	FAS_HUMAN	1470-1522	53	0	-	-
1.27	ENST00000306749	27	ENSE00001163312	chr17:80042592-80042389	204	FAS_HUMAN	1522-1590	69	0	-	-
1.28	ENST00000306749	28	ENSE00001163306	chr17:80042260-80042110	151	FAS_HUMAN	1590-1640	51	0	-	-
1.29	ENST00000306749	29	ENSE00001163299	chr17:80042029-80041851	179	FAS_HUMAN	1640-1700	61	0	-	-
1.30	ENST00000306749	30	ENSE00001163293	chr17:80041767-80041648	120	FAS_HUMAN	1700-1740	41	0	-	-
1.31	ENST00000306749	31	ENSE00001163286	chr17:80041515-80041393	123	FAS_HUMAN	1740-1781	42	0	-	-
1.32	ENST00000306749	32	ENSE00001163279	chr17:80041301-80041078	224	FAS_HUMAN	1781-1855	75	0	-	-
1.33	ENST00000306749	33	ENSE00001163273	chr17:80040991-80040790	202	FAS_HUMAN	1856-1923	68	0	-	-
1.34	ENST00000306749	34	ENSE00001163268	chr17:80040554-80040403	152	FAS_HUMAN	1923-1973	51	0	-	-
1.35	ENST00000306749	35	ENSE00001163265	chr17:80040290-80040199	92	FAS_HUMAN	1974-2004	31	0	-	-
1.36	ENST00000306749	36	ENSE00001163260	chr17:80040036-80039885	152	FAS_HUMAN	2004-2055	52	0	-	-
1.37	ENST00000306749	37	ENSE00001163254	chr17:80039719-80039477	243	FAS_HUMAN	2055-2136	82	0	-	-
1.38	ENST00000306749	38	ENSE00001188261	chr17:80039228-80039040	189	FAS_HUMAN	2136-2199	64	0	-	-
1.39	ENST00000306749	39	ENSE00001163246	chr17:80038798-80038568	231	FAS_HUMAN	2199-2276	78	1	A:2218-2276	59
1.40	ENST00000306749	40	ENSE00001188253	chr17:80038466-80038246	221	FAS_HUMAN	2276-2349	74	1	A:2276-2349	74
1.41	ENST00000306749	41	ENSE00001155362	chr17:80038114-80038016	99	FAS_HUMAN	2350-2382	33	1	A:2350-2382	33
1.42	ENST00000306749	42	ENSE00001163220	chr17:80037484-80037233	252	FAS_HUMAN	2383-2466	84	1	A:2383-2466 (gaps)	84
1.43	ENST00000306749	43	ENSE00001321585	chr17:80037156-80036215	942	FAS_HUMAN	2467-2511	45	1	A:2467-2500	34

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:275
 aligned with FAS_HUMAN | P49327 from UniProtKB/Swiss-Prot  Length:2511

    Alignment length:283
                                  2227      2237      2247      2257      2267      2277      2287      2297      2307      2317      2327      2337      2347      2357      2367      2377      2387      2397      2407      2417      2427      2437      2447      2457      2467      2477      2487      2497   
           FAS_HUMAN   2218 NLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS 2500
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh.......eee..........eeee......hhhhhhhhhhh...eeee.........hhhhhhhhhhhhhh........eeeeehhhhhhhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.........eeeee.--------......hhhhh....eeeee.....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.39  PDB: A:2218-2276 UniProt: 2199-2276 [INCOMPLETE]-------------------------------------------------------------------------Exon 1.41  PDB: A:2350-2382      Exon 1.42  PDB: A:2383-2466 (gaps) UniProt: 2383-2466                               Exon 1.43  PDB: A:2467-2500        Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.40  PDB: A:2276-2349 UniProt: 2276-2349                            ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                3tjm A 2218 NLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTGSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRA--------AAGADYNLSQVCDGKVSVHVIEGDHATLLEGSGLESIISIIHSS 2500
                                  2227      2237      2247      2257      2267      2277      2287      2297      2307      2317      2327      2337      2347      2357      2367      2377      2387      2397      2407      2417      2427      2437      2447|     2457      2467      2477      2487      2497   
                                                                                                                                                                                                                                                               2448     2457

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3TJM)

(no "CATH Domain" information available for 3TJM)

(no "Pfam Domain" information available for 3TJM)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (FAS_HUMAN | P49327)

molecular function
	GO:0019171	3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity	Catalysis of the reaction: a (3R)-3-hydroxyacyl-[acyl-carrier protein] = H2O + a trans-delta2-enoyl-acyl-[acyl-carrier protein].
	GO:0047451	3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity	Catalysis of the reaction: (3R)-3-hydroxyoctanoyl-[acyl-carrier protein] = H2O + 2-octenoyl-[acyl-carrier protein].
	GO:0004317	3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity	Catalysis of the reaction: (3R)-3-hydroxypalmitoyl-[acyl-carrier protein] = 2-hexadecenoyl-[acyl-carrier protein] + H2O.
	GO:0004316	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	Catalysis of the reaction: (3R)-3-hydroxyacyl-[acyl-carrier protein] + NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+.
	GO:0004315	3-oxoacyl-[acyl-carrier-protein] synthase activity	Catalysis of the reaction: acyl-[acyl-carrier protein] + malonyl-[acyl-carrier protein] = 3-oxoacyl-[acyl-carrier protein] + CO2 + [acyl-carrier protein].
	GO:0070402	NADPH binding	Interacting selectively and non-covalently with the reduced form, NADPH, of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions.
	GO:0004313	[acyl-carrier-protein] S-acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + [acyl-carrier protein] = CoA + acetyl-[acyl-carrier protein].
	GO:0004314	[acyl-carrier-protein] S-malonyltransferase activity	Catalysis of the reaction: malonyl-CoA + [acyl-carrier protein] = CoA + malonyl-[acyl-carrier protein].
	GO:0016297	acyl-[acyl-carrier-protein] hydrolase activity	Catalysis of the reaction: acyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + a fatty acid.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0008144	drug binding	Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
	GO:0047117	enoyl-[acyl-carrier-protein] reductase (NADPH, A-specific) activity	Catalysis of the reaction: acyl-[acyl-carrier protein] + NADP+ = trans-D2-enoyl-[acyl-carrier protein] + NADPH + H+.
	GO:0004319	enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific) activity	Catalysis of the reaction: acyl-[acyl-carrier protein] + NADP+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADPH + H+.
	GO:0004312	fatty acid synthase activity	Catalysis of the reaction: acetyl-CoA + n malonyl-CoA + 2n NADPH + 2n H+ = long-chain fatty acid + n+1 CoA + n CO2 + 2n NADP+.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016788	hydrolase activity, acting on ester bonds	Catalysis of the hydrolysis of any ester bond.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0016295	myristoyl-[acyl-carrier-protein] hydrolase activity	Catalysis of the reaction: myristoyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + myristate.
	GO:0004320	oleoyl-[acyl-carrier-protein] hydrolase activity	Catalysis of the reaction: oleoyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + oleate.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016296	palmitoyl-[acyl-carrier-protein] hydrolase activity	Catalysis of the reaction: palmitoyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + palmitate.
	GO:0031177	phosphopantetheine binding	Interacting selectively and non-covalently with phosphopantetheine, the vitamin pantetheine 4'-(dihydrogen phosphate).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006084	acetyl-CoA metabolic process	The chemical reactions and pathways involving acetyl-CoA, a derivative of coenzyme A in which the sulfhydryl group is acetylated; it is a metabolite derived from several pathways (e.g. glycolysis, fatty acid oxidation, amino-acid catabolism) and is further metabolized by the tricarboxylic acid cycle. It is a key intermediate in lipid and terpenoid biosynthesis.
	GO:0009058	biosynthetic process	The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
	GO:0071353	cellular response to interleukin-4	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-4 stimulus.
	GO:0006633	fatty acid biosynthetic process	The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0035338	long-chain fatty-acyl-CoA biosynthetic process	The chemical reactions and pathways resulting in the formation of a long-chain fatty-acyl-CoA any derivative of coenzyme A in which the sulfhydryl group is in a thioester linkage with a long-chain fatty-acyl group. Long-chain fatty-acyl-CoAs have chain lengths of C13 or more.
	GO:0030879	mammary gland development	The process whose specific outcome is the progression of the mammary gland over time, from its formation to the mature structure. The mammary gland is a large compound sebaceous gland that in female mammals is modified to secrete milk. Its development starts with the formation of the mammary line and ends as the mature gland cycles between nursing and weaning stages.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0001649	osteoblast differentiation	The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015939	pantothenate metabolic process	The chemical reactions and pathways involving pantothenate, the anion of pantothenic acid, the amide of beta-alanine and pantoic acid. It is a B complex vitamin that is a constituent of coenzyme A and is distributed ubiquitously in foods.
	GO:0031325	positive regulation of cellular metabolic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways by which individual cells transform chemical substances.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0042587	glycogen granule	Cytoplasmic bead-like structures of animal cells, visible by electron microscope. Each granule is a functional unit with the biosynthesis and catabolism of glycogen being catalyzed by enzymes bound to the granule surface.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		7FA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:2300 - Pro A:2301	[ RasMol ]
		Ser A:2326 - Pro A:2327	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3tjm
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FAS_HUMAN \| P49327
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.100
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	1.3.1.10
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	2.3.1.38
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	2.3.1.39
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	2.3.1.41
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	2.3.1.85
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	3.1.2.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	4.2.1.61
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FAS_HUMAN \| P49327
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	FAS_HUMAN \| P49327	:	1xkt 2cg5 2jfd 2jfk 2px6 3hhd 4piv 4w82 4w9n 4z49 5c37

(no "Related Entries Specified in the PDB File" available for 3TJM)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (48, 48)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File