Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE THIOESTERASE DOMAIN OF HUMAN FATTY ACID SYNTHASE INHIBITED BY ORLISTAT
 
Authors :  C. W. Pemble Iv, L. C. Johnson, S. J. Kridel, W. T. Lowther
Date :  14 May 07  (Deposition) - 10 Jul 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Thioesaterse Domain, Orlistat, Fatty Acid Synthase, Drug Complex, Tetrahydrolipstatin, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. W. Pemble, L. C. Johnson, S. J. Kridel, W. T. Lowther
Crystal Structure Of The Thioesterase Domain Of Human Fatty Acid Synthase Inhibited By Orlistat.
Nat. Struct. Mol. Biol. V. 14 704 2007
PubMed-ID: 17618296  |  Reference-DOI: 10.1038/NSMB1265
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THIOESTERASE DOMAIN
    ChainsA, B
    EC Number2.3.1.85
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainC41(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 2200-2511
    GeneFAS
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1DH92Ligand/Ion(2S,3S,5S)-5-[(N-FORMYL-L-LEUCYL)OXY]-2-HEXYL-3-HYDROXYHEXADECANOIC ACID
2DTT1Ligand/Ion2,3-DIHYDROXY-1,4-DITHIOBUTANE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1DH91Ligand/Ion(2S,3S,5S)-5-[(N-FORMYL-L-LEUCYL)OXY]-2-HEXYL-3-HYDROXYHEXADECANOIC ACID
2DTT-1Ligand/Ion2,3-DIHYDROXY-1,4-DITHIOBUTANE
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1DH91Ligand/Ion(2S,3S,5S)-5-[(N-FORMYL-L-LEUCYL)OXY]-2-HEXYL-3-HYDROXYHEXADECANOIC ACID
2DTT1Ligand/Ion2,3-DIHYDROXY-1,4-DITHIOBUTANE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:2222 , PRO A:2249 , ILE A:2250 , GLU A:2251 , SER A:2308 , TYR A:2309 , TYR A:2343 , ALA A:2363 , PHE A:2370 , PHE A:2423 , HIS A:2481 , ARG A:2482BINDING SITE FOR RESIDUE DH9 A 3000
2AC2SOFTWAREHOH B:5 , SER B:2308 , TYR B:2309 , TYR B:2343 , ALA B:2363 , PHE B:2370 , GLN B:2374 , PHE B:2423 , GLU B:2431BINDING SITE FOR RESIDUE DH9 B 61
3AC3SOFTWARELEU A:2279 , ASP A:2280 , SER A:2422 , TYR A:2425 , SER B:2281 , HIS B:2283 , SER B:2284 , ALA B:2287BINDING SITE FOR RESIDUE DTT B 71

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PX6)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Gly A:2300 -Pro A:2301
2Thr A:2342 -Tyr A:2343
3Gly B:2300 -Pro B:2301
4Ser B:2326 -Pro B:2327

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PX6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2PX6)

(-) Exons   (5, 10)

Asymmetric Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003067491ENSE00001379760chr17:80056106-80055997110FAS_HUMAN-00--
1.2ENST000003067492ENSE00001188368chr17:80054328-80054195134FAS_HUMAN1-43430--
1.3ENST000003067493ENSE00001163495chr17:80053348-80053196153FAS_HUMAN43-94520--
1.4ENST000003067494ENSE00001163489chr17:80051647-80051474174FAS_HUMAN94-152590--
1.5ENST000003067495ENSE00001163482chr17:80051295-80051095201FAS_HUMAN152-219680--
1.6ENST000003067496ENSE00001163474chr17:80050895-80050773123FAS_HUMAN219-260420--
1.7ENST000003067497ENSE00001163463chr17:80050688-80050573116FAS_HUMAN260-298390--
1.8ENST000003067498ENSE00001163453chr17:80050465-80050331135FAS_HUMAN299-343450--
1.9ENST000003067499ENSE00001163444chr17:80049560-80049098463FAS_HUMAN344-4981550--
1.10ENST0000030674910ENSE00001163437chr17:80048945-80048758188FAS_HUMAN498-560630--
1.11ENST0000030674911ENSE00001163429chr17:80048440-80048251190FAS_HUMAN561-624640--
1.12ENST0000030674912ENSE00001163421chr17:80047602-8004750895FAS_HUMAN624-655320--
1.13ENST0000030674913ENSE00001163412chr17:80047260-80047126135FAS_HUMAN656-700450--
1.14ENST0000030674914ENSE00001163403chr17:80047048-80046845204FAS_HUMAN701-768680--
1.15ENST0000030674915ENSE00001163393chr17:80046752-80046637116FAS_HUMAN769-807390--
1.16ENST0000030674916ENSE00001163385chr17:80046438-80046266173FAS_HUMAN807-865590--
1.17ENST0000030674917ENSE00001163378chr17:80046183-80045992192FAS_HUMAN865-929650--
1.18ENST0000030674918ENSE00001163370chr17:80045910-8004583081FAS_HUMAN929-956280--
1.19ENST0000030674919ENSE00001163364chr17:80045737-80045561177FAS_HUMAN956-1015600--
1.20ENST0000030674920ENSE00001163353chr17:80045380-80045201180FAS_HUMAN1015-1075610--
1.21ENST0000030674921ENSE00001163343chr17:80045129-80044926204FAS_HUMAN1075-1143690--
1.22ENST0000030674922ENSE00001163338chr17:80044434-80044130305FAS_HUMAN1143-12441020--
1.23ENST0000030674923ENSE00001163334chr17:80043747-80043358390FAS_HUMAN1245-13741300--
1.24ENST0000030674924ENSE00001163328chr17:80043278-80043114165FAS_HUMAN1375-1429550--
1.25ENST0000030674925ENSE00001163322chr17:80043032-80042911122FAS_HUMAN1430-1470410--
1.26ENST0000030674926ENSE00001163317chr17:80042829-80042675155FAS_HUMAN1470-1522530--
1.27ENST0000030674927ENSE00001163312chr17:80042592-80042389204FAS_HUMAN1522-1590690--
1.28ENST0000030674928ENSE00001163306chr17:80042260-80042110151FAS_HUMAN1590-1640510--
1.29ENST0000030674929ENSE00001163299chr17:80042029-80041851179FAS_HUMAN1640-1700610--
1.30ENST0000030674930ENSE00001163293chr17:80041767-80041648120FAS_HUMAN1700-1740410--
1.31ENST0000030674931ENSE00001163286chr17:80041515-80041393123FAS_HUMAN1740-1781420--
1.32ENST0000030674932ENSE00001163279chr17:80041301-80041078224FAS_HUMAN1781-1855750--
1.33ENST0000030674933ENSE00001163273chr17:80040991-80040790202FAS_HUMAN1856-1923680--
1.34ENST0000030674934ENSE00001163268chr17:80040554-80040403152FAS_HUMAN1923-1973510--
1.35ENST0000030674935ENSE00001163265chr17:80040290-8004019992FAS_HUMAN1974-2004310--
1.36ENST0000030674936ENSE00001163260chr17:80040036-80039885152FAS_HUMAN2004-2055520--
1.37ENST0000030674937ENSE00001163254chr17:80039719-80039477243FAS_HUMAN2055-2136820--
1.38ENST0000030674938ENSE00001188261chr17:80039228-80039040189FAS_HUMAN2136-2199640--
1.39ENST0000030674939ENSE00001163246chr17:80038798-80038568231FAS_HUMAN2199-2276782A:2221-2276
B:2221-2276
56
56
1.40ENST0000030674940ENSE00001188253chr17:80038466-80038246221FAS_HUMAN2276-2349742A:2276-2343 (gaps)
B:2276-2343
68
68
1.41ENST0000030674941ENSE00001155362chr17:80038114-8003801699FAS_HUMAN2350-2382332A:2361-2382
B:2360-2382
22
23
1.42ENST0000030674942ENSE00001163220chr17:80037484-80037233252FAS_HUMAN2383-2466842A:2383-2466 (gaps)
B:2383-2466 (gaps)
84
84
1.43ENST0000030674943ENSE00001321585chr17:80037156-80036215942FAS_HUMAN2467-2511452A:2467-2501
B:2467-2507
35
41

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:253
 aligned with FAS_HUMAN | P49327 from UniProtKB/Swiss-Prot  Length:2511

    Alignment length:281
                                  2230      2240      2250      2260      2270      2280      2290      2300      2310      2320      2330      2340      2350      2360      2370      2380      2390      2400      2410      2420      2430      2440      2450      2460      2470      2480      2490      2500 
           FAS_HUMAN   2221 SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL 2501
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2px6A01 A:2221-2342,A:2433-2501  [code=3.40.50.1820, no name defined]                                                     2                 px6A02 A:2343-2432 Fatty acid synthase; domain 2                        2px6A01 A:2221-234        2,A:2433-2501  [code=3.40.50.1820, no name  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee..........eeee......hhhhhhhhhhh...eeee.........hhhhhhhhhhhhhh........eeeeehhhhhhhhhhhhhhhhhh---....eeeee......-----------------hhhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh..........eeeeee..--------.............eeeeee....hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.39  PDB: A:2221-2276 UniProt: 2199-2276          -------------------------------------------------------------------------Exon 1.41  PDB: A:2361-2382      Exon 1.42  PDB: A:2383-2466 (gaps) UniProt: 2383-2466                               Exon 1.43  PDB: A:2467-2501         Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.40  PDB: A:2276-2343 (gaps) UniProt: 2276-2349 [INCOMPLETE]        -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                2px6 A 2221 SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQ---PTHNSLFLFDGSPTY-----------------AEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKT--------GADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL 2501
                                  2230      2240      2250      2260      2270      2280      2290      2300      2310      2320    | 2330      2340  |      -         -|     2370      2380      2390      2400      2410      2420      2430      2440      2450      2460      2470      2480      2490      2500 
                                                                                                                                 2325   |          2343              2361                                                                                     2450     2459                                          
                                                                                                                                     2329                                                                                                                                                                            

Chain B from PDB  Type:PROTEIN  Length:263
 aligned with FAS_HUMAN | P49327 from UniProtKB/Swiss-Prot  Length:2511

    Alignment length:287
                                  2230      2240      2250      2260      2270      2280      2290      2300      2310      2320      2330      2340      2350      2360      2370      2380      2390      2400      2410      2420      2430      2440      2450      2460      2470      2480      2490      2500       
           FAS_HUMAN   2221 SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVS 2507
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2px6B01 B:2221-2343,B:2433-2507  [code=3.40.50.1820, no name defined]                                                                      2px6B02 B:2360-2432 Fatty acid synthase; domain 2                        2px6B01 B:2221-2343,        B:2433-2507  [code=3.40.50.1820, no name define CATH domains
           Pfam domains (1) ---------------------Thioesterase-2px6B01 B:2242-2501                                                                                                                                                                                                                                    ------ Pfam domains (1)
           Pfam domains (2) ---------------------Thioesterase-2px6B02 B:2242-2501                                                                                                                                                                                                                                    ------ Pfam domains (2)
         Sec.struct. author ..........eee..........eeee......hhhhhhhhhhh...eeee.........hhhhhhhhhhhhhh........eeeeehhhhhhhhhhhhhhhhhhh......eeeee......----------------hhhhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh..........eeeeee....--------...........eeeeee....hhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.39  PDB: B:2221-2276 UniProt: 2199-2276          -------------------------------------------------------------------------Exon 1.41  PDB: B:2360-2382      Exon 1.42  PDB: B:2383-2466 (gaps) UniProt: 2383-2466                               Exon 1.43  PDB: B:2467-2507 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.40  PDB: B:2276-2343 UniProt: 2276-2349 [INCOMPLETE]               -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                2px6 B 2221 SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTY----------------EAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGG--------DYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVS 2507
                                  2230      2240      2250      2260      2270      2280      2290      2300      2310      2320      2330      2340  |      -      2360      2370      2380      2390      2400      2410      2420      2430      2440      2450 |       -|     2470      2480      2490      2500       
                                                                                                                                                   2343             2360                                                                                        2452     2461                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2PX6)

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (48, 48)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (FAS_HUMAN | P49327)
molecular function
    GO:0019171    3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity    Catalysis of the reaction: a (3R)-3-hydroxyacyl-[acyl-carrier protein] = H2O + a trans-delta2-enoyl-acyl-[acyl-carrier protein].
    GO:0047451    3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity    Catalysis of the reaction: (3R)-3-hydroxyoctanoyl-[acyl-carrier protein] = H2O + 2-octenoyl-[acyl-carrier protein].
    GO:0004317    3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity    Catalysis of the reaction: (3R)-3-hydroxypalmitoyl-[acyl-carrier protein] = 2-hexadecenoyl-[acyl-carrier protein] + H2O.
    GO:0004316    3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity    Catalysis of the reaction: (3R)-3-hydroxyacyl-[acyl-carrier protein] + NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+.
    GO:0004315    3-oxoacyl-[acyl-carrier-protein] synthase activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + malonyl-[acyl-carrier protein] = 3-oxoacyl-[acyl-carrier protein] + CO2 + [acyl-carrier protein].
    GO:0070402    NADPH binding    Interacting selectively and non-covalently with the reduced form, NADPH, of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions.
    GO:0004313    [acyl-carrier-protein] S-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + [acyl-carrier protein] = CoA + acetyl-[acyl-carrier protein].
    GO:0004314    [acyl-carrier-protein] S-malonyltransferase activity    Catalysis of the reaction: malonyl-CoA + [acyl-carrier protein] = CoA + malonyl-[acyl-carrier protein].
    GO:0016297    acyl-[acyl-carrier-protein] hydrolase activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + a fatty acid.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0008144    drug binding    Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
    GO:0047117    enoyl-[acyl-carrier-protein] reductase (NADPH, A-specific) activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + NADP+ = trans-D2-enoyl-[acyl-carrier protein] + NADPH + H+.
    GO:0004319    enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific) activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + NADP+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADPH + H+.
    GO:0004312    fatty acid synthase activity    Catalysis of the reaction: acetyl-CoA + n malonyl-CoA + 2n NADPH + 2n H+ = long-chain fatty acid + n+1 CoA + n CO2 + 2n NADP+.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016788    hydrolase activity, acting on ester bonds    Catalysis of the hydrolysis of any ester bond.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0016295    myristoyl-[acyl-carrier-protein] hydrolase activity    Catalysis of the reaction: myristoyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + myristate.
    GO:0004320    oleoyl-[acyl-carrier-protein] hydrolase activity    Catalysis of the reaction: oleoyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + oleate.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016296    palmitoyl-[acyl-carrier-protein] hydrolase activity    Catalysis of the reaction: palmitoyl-[acyl-carrier protein] + H2O = [acyl-carrier protein] + palmitate.
    GO:0031177    phosphopantetheine binding    Interacting selectively and non-covalently with phosphopantetheine, the vitamin pantetheine 4'-(dihydrogen phosphate).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006084    acetyl-CoA metabolic process    The chemical reactions and pathways involving acetyl-CoA, a derivative of coenzyme A in which the sulfhydryl group is acetylated; it is a metabolite derived from several pathways (e.g. glycolysis, fatty acid oxidation, amino-acid catabolism) and is further metabolized by the tricarboxylic acid cycle. It is a key intermediate in lipid and terpenoid biosynthesis.
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
    GO:0071353    cellular response to interleukin-4    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-4 stimulus.
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0035338    long-chain fatty-acyl-CoA biosynthetic process    The chemical reactions and pathways resulting in the formation of a long-chain fatty-acyl-CoA any derivative of coenzyme A in which the sulfhydryl group is in a thioester linkage with a long-chain fatty-acyl group. Long-chain fatty-acyl-CoAs have chain lengths of C13 or more.
    GO:0030879    mammary gland development    The process whose specific outcome is the progression of the mammary gland over time, from its formation to the mature structure. The mammary gland is a large compound sebaceous gland that in female mammals is modified to secrete milk. Its development starts with the formation of the mammary line and ends as the mature gland cycles between nursing and weaning stages.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0001649    osteoblast differentiation    The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015939    pantothenate metabolic process    The chemical reactions and pathways involving pantothenate, the anion of pantothenic acid, the amide of beta-alanine and pantoic acid. It is a B complex vitamin that is a constituent of coenzyme A and is distributed ubiquitously in foods.
    GO:0031325    positive regulation of cellular metabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways by which individual cells transform chemical substances.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0042587    glycogen granule    Cytoplasmic bead-like structures of animal cells, visible by electron microscope. Each granule is a functional unit with the biosynthesis and catabolism of glycogen being catalyzed by enzymes bound to the granule surface.
    GO:0042470    melanosome    A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DH9  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DTT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:2300 - Pro A:2301   [ RasMol ]  
    Gly B:2300 - Pro B:2301   [ RasMol ]  
    Ser B:2326 - Pro B:2327   [ RasMol ]  
    Thr A:2342 - Tyr A:2343   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2px6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FAS_HUMAN | P49327
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.85
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FAS_HUMAN | P49327
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FAS_HUMAN | P493271xkt 2cg5 2jfd 2jfk 3hhd 3tjm 4piv 4w82 4w9n 4z49 5c37

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PX6)