3TFY - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   NAA50P AMINO-TERMINAL ACETYLTRANSFERASE BOUND TO SUBSTRATE PEPTIDE FRAGMENT AND COA

Authors :   G. P. Liszczak, R. Marmorstein

Date :   16 Aug 11 (Deposition) - 07 Sep 11 (Release) - 02 Nov 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.75

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,D  (1x)
Biol. Unit 2: B,E  (1x)
Biol. Unit 3: C,F  (1x)

Keywords :   Transferase, Gnat Family, N(Alpha)-Acetyltransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Liszczak, T. Arnesen, R. Marmorstein
Structure Of A Ternary Naa50P (Nat5/San) N-Terminal Acetyltransferase Complex Reveals The Molecular Basis For Substrate-Specific Acetylation.
J. Biol. Chem. V. 286 37002 2011
PubMed-ID: 21900231 | Reference-DOI: 10.1074/JBC.M111.282863

Molecule 1 - N-ALPHA-ACETYLTRANSFERASE 50, NATE CATALYTIC SUBUNIT
	Chains	:	A, B, C
	EC Number	:	2.3.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PETM-GST
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	MAK3, NAA50, NAT13, NAT5
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	N-ACETYLTRANSFERASE 13, N-ACETYLTRANSFERASE 5, HNAT5, N- ACETYLTRANSFERASE SAN HOMOLOG, HSAN

Molecule 2 - HNRNP F
	Chains	:	D, E, F
	Engineered	:	YES
	Synthetic	:	YES

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A			D
Biological Unit 2 (1x)	:		B			E
Biological Unit 3 (1x)	:			C			F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 3)

No.	Name	Count	Type	Full Name
1	COA	3	Ligand/Ion	COENZYME A

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE A:27 , LEU A:77 , GLY A:78 , CYS A:79 , ARG A:84 , ARG A:85 , LEU A:86 , GLY A:87 , ILE A:88 , GLY A:89 , THR A:90 , ASN A:117 , SER A:119 , ASP A:122 , PHE A:123 , TYR A:124 , LYS A:126 , HOH A:170 , HOH A:171 , HOH A:177 , HOH A:180 , HOH A:188 , MET D:5122	BINDING SITE FOR RESIDUE COA A 201
2	AC2	SOFTWARE	ILE B:26 , LEU B:77 , GLY B:78 , CYS B:79 , ARG B:84 , ARG B:85 , LEU B:86 , GLY B:87 , ILE B:88 , GLY B:89 , THR B:90 , ASN B:117 , SER B:119 , ASP B:122 , PHE B:123 , LYS B:126 , HOH B:171 , HOH B:172 , HOH B:176 , HOH B:183 , HOH B:187 , MET E:5122	BINDING SITE FOR RESIDUE COA B 201
3	AC3	SOFTWARE	PHE C:27 , LEU C:77 , GLY C:78 , CYS C:79 , ARG C:84 , ARG C:85 , LEU C:86 , GLY C:87 , ILE C:88 , GLY C:89 , THR C:90 , LEU C:111 , ASN C:117 , SER C:119 , PHE C:123 , TYR C:124 , LYS C:126 , HOH C:177 , HOH C:178 , MET F:5122	BINDING SITE FOR RESIDUE COA C 201

(no "SS Bond" information available for 3TFY)

Asymmetric Unit

No.	Residues
1	Glu A:143	-	Pro A:144
2	Gly D:5124	-	Pro D:5125
3	Glu B:143	-	Pro B:144
4	Glu C:143	-	Pro C:144

(no "SAP(SNP)/Variant" information available for 3TFY)

Asymmetric Unit (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	NAA50_HUMAN	6-155	3	A:6-155 B:6-155 C:6-155

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	NAA50_HUMAN	6-155	1	A:6-155 - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	NAA50_HUMAN	6-155	1	- B:6-155 -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	NAA50_HUMAN	6-155	1	- - C:6-155

Asymmetric Unit (6, 16)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000240922	1b	ENSE00001891972	chr3:113465121-113464789	333	NAA50_HUMAN	1-3	3	1	A:1-3 - -	3 - -
1.4c	ENST00000240922	4c	ENSE00001175035	chr3:113442942-113442806	137	NAA50_HUMAN	3-49	47	3	A:3-49 B:4-49 C:4-49	47 46 46
1.5b	ENST00000240922	5b	ENSE00000823545	chr3:113442388-113442269	120	NAA50_HUMAN	49-89	41	3	A:49-89 B:49-89 C:49-89	41 41 41
1.6	ENST00000240922	6	ENSE00000823544	chr3:113441819-113441753	67	NAA50_HUMAN	89-111	23	3	A:89-111 B:89-111 C:89-111	23 23 23
1.7f	ENST00000240922	7f	ENSE00001380209	chr3:113440784-113437841	2944	NAA50_HUMAN	111-169	59	3	A:111-155 B:111-155 C:111-155	45 45 45

2.3	ENST00000357065	3	ENSE00001463539	chr10:43903267-43903165	103	HNRPF_HUMAN	-	0	0	-	-
2.5b	ENST00000357065	5b	ENSE00001360970	chr10:43892038-43891904	135	HNRPF_HUMAN	-	0	0	-	-
2.6	ENST00000357065	6	ENSE00001360956	chr10:43890136-43890078	59	HNRPF_HUMAN	-	0	0	-	-
2.7d	ENST00000357065	7d	ENSE00001552809	chr10:43883384-43881065	2320	HNRPF_HUMAN	1-433	433	3	D:5122-5125 E:5122-5125 F:5122-5125	4 4 4

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:155
 aligned with NAA50_HUMAN | Q9GZZ1 from UniProtKB/Swiss-Prot  Length:169

    Alignment length:155
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150     
         NAA50_HUMAN      1 MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK  155
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee....hhhhhhhhhhhhh....hhhhhhhhhhhhh.eeeeee..eeeeeeeeeeeee..eeeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeee...........eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----GNAT  PDB: A:6-155 UniProt: 6-155                                                                                                                      PROSITE
           Transcript 1 (1) 1.1---------------------------------------------Exon 1.5b  PDB: A:49-89 UniProt: 49-89   ---------------------Exon 1.7f  PDB: A:111-155 UniProt: 111-169    Transcript 1 (1)
           Transcript 1 (2) --Exon 1.4c  PDB: A:3-49 UniProt: 3-49           ---------------------------------------Exon 1.6  PDB: A:89-111-------------------------------------------- Transcript 1 (2)
                3tfy A    1 MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK  155
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain B from PDB  Type:PROTEIN  Length:152
 aligned with NAA50_HUMAN | Q9GZZ1 from UniProtKB/Swiss-Prot  Length:169

    Alignment length:152
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153  
         NAA50_HUMAN      4 SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK  155
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....hhhhhhhhhhhhh....hhhhhhhhhhhh..eeeeee..eeeeeeeeeee......eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhh...eeeeee...........eeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --GNAT  PDB: B:6-155 UniProt: 6-155                                                                                                                      PROSITE
           Transcript 1 (1) ---------------------------------------------Exon 1.5b  PDB: B:49-89 UniProt: 49-89   ---------------------Exon 1.7f  PDB: B:111-155 UniProt: 111-169    Transcript 1 (1)
           Transcript 1 (2) Exon 1.4c  PDB: B:4-49 UniProt: 3-49          ---------------------------------------Exon 1.6  PDB: B:89-111-------------------------------------------- Transcript 1 (2)
                3tfy B    4 SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK  155
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153

Chain C from PDB  Type:PROTEIN  Length:152
 aligned with NAA50_HUMAN | Q9GZZ1 from UniProtKB/Swiss-Prot  Length:169

    Alignment length:152
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153  
         NAA50_HUMAN      4 SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK  155
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....hhhhhhhhhhhhh....hhhhhhhhhhhhh.eeeeee..eeeeeeeeeeeee..eeeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeee...........eeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --GNAT  PDB: C:6-155 UniProt: 6-155                                                                                                                      PROSITE
           Transcript 1 (1) ---------------------------------------------Exon 1.5b  PDB: C:49-89 UniProt: 49-89   ---------------------Exon 1.7f  PDB: C:111-155 UniProt: 111-169    Transcript 1 (1)
           Transcript 1 (2) Exon 1.4c  PDB: C:4-49 UniProt: 3-49          ---------------------------------------Exon 1.6  PDB: C:89-111-------------------------------------------- Transcript 1 (2)
                3tfy C    4 SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK  155
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153

Chain D from PDB  Type:PROTEIN  Length:4
 aligned with HNRPF_HUMAN | P52597 from UniProtKB/Swiss-Prot  Length:415

    Alignment length:4
         HNRPF_HUMAN      2 MLGP    5
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
               Transcript 2 2.7d Transcript 2
                3tfy D 5122 MLGP 5125

Chain E from PDB  Type:PROTEIN  Length:4
 aligned with HNRPF_HUMAN | P52597 from UniProtKB/Swiss-Prot  Length:415

    Alignment length:4
         HNRPF_HUMAN      2 MLGP    5
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
               Transcript 2 2.7d Transcript 2
                3tfy E 5122 MLGP 5125

Chain F from PDB  Type:PROTEIN  Length:4
 aligned with HNRPF_HUMAN | P52597 from UniProtKB/Swiss-Prot  Length:415

    Alignment length:4
         HNRPF_HUMAN      2 MLGP    5
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
               Transcript 2 2.7d Transcript 2
                3tfy F 5122 MLGP 5125

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3TFY)

(no "CATH Domain" information available for 3TFY)

(no "Pfam Domain" information available for 3TFY)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (NAA50_HUMAN | Q9GZZ1)

molecular function
	GO:0010485	H4 histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone H4 = CoA + acetyl-histone H4.
	GO:0008080	N-acetyltransferase activity	Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
	GO:0004596	peptide alpha-N-acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + peptide = CoA + N-alpha-acetylpeptide. This reaction is the acetylation of the N-terminal amino acid residue of a peptide or protein.
	GO:0052858	peptidyl-lysine acetyltransferase activity	Catalysis of the reaction: acetyl phosphate + peptidyl-L-lysine = phosphate + peptidyl-N6-acetyl-L-lysine.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
	GO:0006474	N-terminal protein amino acid acetylation	The acetylation of the N-terminal amino acid of proteins.
	GO:0043967	histone H4 acetylation	The modification of histone H4 by the addition of an acetyl group.
	GO:0071962	mitotic sister chromatid cohesion, centromeric	The cell cycle process in which centromeres of sister chromatids are joined during mitosis.
cellular component
	GO:0031415	NatA complex	A conserved complex that catalyzes the transfer of an acetyl group to an N-terminal Ser, Ala, Gly, or Thr residue of a protein acceptor molecule. In Saccharomyces the complex includes Nat1p and Ard1p, and may contain additional proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Chain D,E,F (HNRPF_HUMAN | P52597)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0017025	TBP-class protein binding	Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003727	single-stranded RNA binding	Interacting selectively and non-covalently with single-stranded RNA.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
	GO:0006396	RNA processing	Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0008543	fibroblast growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
	GO:0010467	gene expression	The process in which a gene's sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0043484	regulation of RNA splicing	Any process that modulates the frequency, rate or extent of RNA splicing, the process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
cellular component
	GO:0071013	catalytic step 2 spliceosome	A spliceosomal complex that contains three snRNPs, including U5, bound to a splicing intermediate in which the first catalytic cleavage of the 5' splice site has occurred. The precise subunit composition differs significantly from that of the catalytic step 1, or activated, spliceosome, and includes many proteins in addition to those found in the associated snRNPs.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:143 - Pro A:144	[ RasMol ]
		Glu B:143 - Pro B:144	[ RasMol ]
		Glu C:143 - Pro C:144	[ RasMol ]
		Gly D:5124 - Pro D:5125	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3tfy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HNRPF_HUMAN \| P52597
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NAA50_HUMAN \| Q9GZZ1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.1.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HNRPF_HUMAN \| P52597
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NAA50_HUMAN \| Q9GZZ1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	HNRPF_HUMAN \| P52597	:	2hgl 2hgm 2hgn 2kfy 2kg0 2kg1
	NAA50_HUMAN \| Q9GZZ1	:	2ob0 2psw 4x5k

2ob0	HUMAN MAK3 HOMOLOG IN COMPLEX WITH ACETYL-COA
2psw	HUMAN MAK3 HOMOLOG IN COMPLEX WITH COA

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 3)

Exons (6, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (32, 34)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File