Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  LOW RESOLUTION STRUCTURE OF STNV COMPLEXED WITH RNA
 
Authors :  S. W. Lane, C. A. Dennis, C. L. Lane, C. H. Trinh, P. J. Rizkallah, P. G. Sto S. E. V. Phillips
Date :  19 May 11  (Deposition) - 03 Aug 11  (Release) - 23 May 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  6.00
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (60x)
Keywords :  Protein-Rna Complex, Low Resolution Structure, Jelly-Roll -Sandwich, Virus Capsid Protein, Virus (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. W. Lane, C. A. Dennis, C. L. Lane, C. H. Trinh, P. J. Rizkallah, P. G. Stockley, S. E. Phillips
Construction And Crystal Structure Of Recombinant Stnv Capsids.
J. Mol. Biol. V. 413 41 2011
PubMed-ID: 21839089  |  Reference-DOI: 10.1016/J.JMB.2011.07.062

(-) Compounds

Molecule 1 - COAT PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET22B
    Expression System Strain: BL21(DE3) PLYSS
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: TOBACCO NECROSIS SATELLITE VIRUS 1
    Organism Taxid: 12445
 
Molecule 2 - RNA (5'-R(P*AP*AP*A)-3')
    Chains: B
    Engineered: YES
    Other Details: ARBITRARY MODELLED RNA STRUCTURE
    Synthetic: YES
 
Molecule 3 - RNA (5'-R(P*UP*UP*UP*U)-3')
    Chains: C
    Engineered: YES
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (60x): ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3S4G)

(-) Sites  (0, 0)

(no "Site" information available for 3S4G)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3S4G)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3S4G)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3S4G)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3S4G)

(-) Exons   (0, 0)

(no "Exon" information available for 3S4G)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:184
 aligned with COAT_STNV1 | P03606 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:184
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192    
           COAT_STNV1    13 TMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA 196
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeeeeeeeeeee.....eeee.................eeeeeeeeeeeeee.....eeeeeeeeee........hhhhhh.........hhhhhhh..eeeeeeeeeee......eeeeeeeee..eee......hhhhh....eeeeeee.....eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3s4g A  12 TMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA 195
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    


Chain B from PDB  Type:RNA  Length:3
                                   
                 3s4g B 196 AAA 198


Chain C from PDB  Type:RNA  Length:4
                                    
                 3s4g C 199 UUUU 202
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3S4G)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3S4G)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3S4G)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A   (COAT_STNV1 | P03606)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3s4g)
 
  Sites
(no "Sites" information available for 3s4g)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3s4g)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3s4g
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COAT_STNV1 | P03606
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COAT_STNV1 | P03606
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COAT_STNV1 | P03606: 2buk 4bcu 4v4m

(-) Related Entries Specified in the PDB File

1vtz 3rqv