Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ALTERNATIVE ANALOGS AS VIABLE SUBSTRATES OF UDP-HEXOSE 4-EPIMERASES
 
Authors :  V. S. Bhatt, W. Guan, P. G. Wang
Date :  05 May 11  (Deposition) - 25 May 11  (Release) - 25 May 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,S,b
Biol. Unit 1:  A (1x),b (1x)
Biol. Unit 2:  B,S  (1x)
Keywords :  Rossmann Fold, Udp-Hexose 4-Epimerase, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  V. S. Bhatt, W. Guan, P. G. Wang
Alternative Analogs As Viable Substrates Of Udp-Hexose 4-Epimerases
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - WBGU
    ChainsA, B, S, b
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneWBGU
    Organism ScientificPLESIOMONAS SHIGELLOIDES
    Organism Taxid703

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABSb
Biological Unit 1 (1x)A (1x)  b (1x)
Biological Unit 2 (1x) BS 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 9)

Asymmetric Unit (3, 9)
No.NameCountTypeFull Name
1NAD4Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
2SO41Ligand/IonSULFATE ION
3UDP4Ligand/IonURIDINE-5'-DIPHOSPHATE
Biological Unit 1 (3, 3)
No.NameCountTypeFull Name
1NAD1Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
2SO41Ligand/IonSULFATE ION
3UDP1Ligand/IonURIDINE-5'-DIPHOSPHATE
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
2SO4-1Ligand/IonSULFATE ION
3UDP2Ligand/IonURIDINE-5'-DIPHOSPHATE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:23 , ALA A:25 , GLY A:26 , PHE A:27 , ILE A:28 , ASP A:47 , ASN A:48 , PHE A:49 , SER A:50 , THR A:51 , GLY A:52 , GLY A:77 , ASP A:78 , ILE A:79 , GLN A:98 , ALA A:99 , ALA A:100 , THR A:117 , ALA A:140 , ALA A:141 , TYR A:166 , LYS A:170 , TYR A:193 , VAL A:196 , HOH A:346 , HOH A:348 , HOH A:380 , HOH A:386 , HOH A:421 , HOH A:462 , HOH A:606BINDING SITE FOR RESIDUE NAD A 343
2AC2SOFTWAREASN A:195 , ALA A:209 , VAL A:210 , LYS A:213 , TRP A:214 , TYR A:225 , ILE A:226 , ASN A:227 , THR A:232 , ARG A:234 , LEU A:271 , ARG A:299 , ASP A:302 , HOH A:359 , HOH A:425 , HOH A:1023BINDING SITE FOR RESIDUE UDP A 344
3AC3SOFTWAREGLY B:23 , ALA B:25 , GLY B:26 , PHE B:27 , ILE B:28 , ASP B:47 , ASN B:48 , PHE B:49 , SER B:50 , THR B:51 , GLY B:52 , GLY B:77 , ASP B:78 , ILE B:79 , GLN B:98 , ALA B:99 , ALA B:100 , THR B:117 , ALA B:140 , ALA B:141 , TYR B:166 , LYS B:170 , TYR B:193 , ASN B:195 , VAL B:196 , HOH B:346 , HOH B:348 , HOH B:368 , HOH B:377 , HOH B:390 , HOH B:392 , HOH B:404 , HOH B:407 , HOH B:578BINDING SITE FOR RESIDUE NAD B 343
4AC4SOFTWAREASN B:195 , ALA B:209 , VAL B:210 , LYS B:213 , TYR B:225 , ILE B:226 , ASN B:227 , THR B:232 , ARG B:234 , LEU B:271 , ARG B:299 , ASP B:302 , HOH B:372 , HOH B:388 , HOH B:412 , HOH B:746BINDING SITE FOR RESIDUE UDP B 344
5AC5SOFTWAREGLY S:23 , ALA S:25 , GLY S:26 , PHE S:27 , ILE S:28 , LEU S:46 , ASP S:47 , ASN S:48 , PHE S:49 , SER S:50 , THR S:51 , GLY S:52 , GLY S:77 , ASP S:78 , ILE S:79 , GLN S:98 , ALA S:99 , ALA S:100 , THR S:117 , ALA S:140 , ALA S:141 , TYR S:166 , LYS S:170 , TYR S:193 , ASN S:195 , VAL S:196 , HOH S:367 , HOH S:372 , HOH S:388 , HOH S:393 , HOH S:491 , HOH S:500BINDING SITE FOR RESIDUE NAD S 343
6AC6SOFTWAREASN S:195 , VAL S:210 , LYS S:213 , TRP S:214 , TYR S:225 , ILE S:226 , ASN S:227 , THR S:232 , ARG S:234 , LEU S:271 , ARG S:299 , ASP S:302 , HOH S:380 , HOH S:381 , HOH S:463BINDING SITE FOR RESIDUE UDP S 344
7AC7SOFTWAREGLY b:23 , ALA b:25 , GLY b:26 , PHE b:27 , ILE b:28 , ASP b:47 , ASN b:48 , PHE b:49 , SER b:50 , THR b:51 , GLY b:52 , GLY b:77 , ASP b:78 , ILE b:79 , GLN b:98 , ALA b:99 , ALA b:100 , THR b:117 , ALA b:140 , ALA b:141 , TYR b:166 , LYS b:170 , TYR b:193 , ASN b:195 , VAL b:196 , HOH b:356 , HOH b:363 , HOH b:381 , HOH b:393 , HOH b:401 , HOH b:408 , HOH b:412 , HOH b:415BINDING SITE FOR RESIDUE NAD b 344
8AC8SOFTWAREASN b:195 , ALA b:209 , VAL b:210 , LYS b:213 , TRP b:214 , TYR b:225 , ASN b:227 , THR b:232 , ARG b:234 , LEU b:271 , ARG b:299 , ASP b:302 , HOH b:391 , HOH b:394 , HOH b:476BINDING SITE FOR RESIDUE UDP b 343
9AC9SOFTWAREARG A:4 , LYS A:253 , LYS A:318 , HIS B:53 , GLN B:54 , TYR B:55BINDING SITE FOR RESIDUE SO4 A 345

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3RUF)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:152 -Pro A:153
2Leu B:152 -Pro B:153
3Leu S:152 -Pro S:153
4Leu b:152 -Pro b:153

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3RUF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3RUF)

(-) Exons   (0, 0)

(no "Exon" information available for 3RUF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:336
 aligned with GNE_PLESH | Q7BJX9 from UniProtKB/Swiss-Prot  Length:345

    Alignment length:341
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343 
            GNE_PLESH     4 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIDKLSIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 344
               SCOP domains d3rufa_ A: automated matches                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhh.hhhhhh.eeeee....hhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhh................hhhhhhhhhhhhhhhhhhhhhh...eeeee..ee...........hhhhhhhhhhhhh...eee.....ee..eehhhhhhhhhhhhh.hhhhh.eeeee.....eehhhhhhhhhhhhhh...-----.eee.............hhhhhhhhh.....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ruf A   1 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHH-----IKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 341
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280      |  -  |    300       310       320       330       340 
                                                                                                                                                                                                                                                                                                                        287   293                                                

Chain B from PDB  Type:PROTEIN  Length:336
 aligned with GNE_PLESH | Q7BJX9 from UniProtKB/Swiss-Prot  Length:345

    Alignment length:341
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343 
            GNE_PLESH     4 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIDKLSIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 344
               SCOP domains d3rufb_ B: automated matches                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhh.eeeee....hhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhh................hhhhhhhhhhhhhhhhhhhhhh...eeeee..ee...........hhhhhhhhhhhhh...eee.....ee..eehhhhhhhhhhhhh.hhhhh.eeeee.....eehhhhhhhhhhhhhh...-----.eee.............hhhhhhhhh.....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ruf B   1 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHH-----IKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 341
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280      |  -  |    300       310       320       330       340 
                                                                                                                                                                                                                                                                                                                        287   293                                                

Chain S from PDB  Type:PROTEIN  Length:336
 aligned with GNE_PLESH | Q7BJX9 from UniProtKB/Swiss-Prot  Length:345

    Alignment length:341
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343 
            GNE_PLESH     4 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIDKLSIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 344
               SCOP domains d3rufs_ S: automated matches                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhh.hhhhhh.eeeee....hhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhh................hhhhhhhhhhhhhhhhhhhhhh...eeeee..ee...........hhhhhhhhhhhhh...eee.....ee..eehhhhhhhhhhhhh.hhhhh.eeeee.....eehhhhhhhhhhhhhh...-----.eee.............hhhhhhhhh.....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ruf S   1 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHH-----IKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 341
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280      |  -  |    300       310       320       330       340 
                                                                                                                                                                                                                                                                                                                        287   293                                                

Chain b from PDB  Type:PROTEIN  Length:336
 aligned with GNE_PLESH | Q7BJX9 from UniProtKB/Swiss-Prot  Length:345

    Alignment length:341
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343 
            GNE_PLESH     4 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIDKLSIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 344
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhh.hhhhhh.eeeee....hhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhh................hhhhhhhhhhhhhhhhhhhhhh...eeeee..ee...........hhhhhhhhhhhhh...eee.....ee..eehhhhhhhhhhhhh.hhhhh.eeeee.....eehhhhhhhhhhhhhh...-----.eee.............hhhhhhhhh.....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ruf b   1 YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHH-----IKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK 341
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280      |  -  |    300       310       320       330       340 
                                                                                                                                                                                                                                                                                                                        287   293                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3RUF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3RUF)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A,B,S,b   (GNE_PLESH | Q7BJX9)
molecular function
    GO:0003974    UDP-N-acetylglucosamine 4-epimerase activity    Catalysis of the reaction: UDP-N-acetyl-D-glucosamine = UDP-N-acetyl-D-galactosamine.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0050662    coenzyme binding    Interacting selectively and non-covalently with a coenzyme, any of various nonprotein organic cofactors that are required, in addition to an enzyme and a substrate, for an enzymatic reaction to proceed.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016857    racemase and epimerase activity, acting on carbohydrates and derivatives    Catalysis of a reaction that alters the configuration of one or more chiral centers in a carbohydrate molecule.
biological process
    GO:0009243    O antigen biosynthetic process    The chemical reactions and pathways resulting in the formation of the O side chain of a lipopolysaccharide, which determines the antigenic specificity of the organism. It is made up of about 50 repeating units of a branched tetrasaccharide.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:152 - Pro A:153   [ RasMol ]  
    Leu B:152 - Pro B:153   [ RasMol ]  
    Leu S:152 - Pro S:153   [ RasMol ]  
    Leu b:152 - Pro b:153   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ruf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GNE_PLESH | Q7BJX9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GNE_PLESH | Q7BJX9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GNE_PLESH | Q7BJX93lu1 3ru7 3ru9 3rua 3ruc 3rud 3rue 3ruh

(-) Related Entries Specified in the PDB File

3ru7 3ru9 3rua 3ruc 3rud 3rue 3ruh