3RPN - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN KAPPA CLASS GLUTATHIONE TRANSFERASE IN COMPLEX WITH S-HEXYLGLUTATHIONE

Authors :   B. Wang, Y. Peng, T. Zhang, J. Ding

Date :   27 Apr 11 (Deposition) - 13 Jul 11 (Release) - 03 Jul 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,D  (1x)
Biol. Unit 2: B,E  (1x)
Biol. Unit 3: C,F  (1x)

Keywords :   Kappa Gst, Trx Domain, Gsh Binding, Detoxification, Gtx, Glutathione Transferase Inhibitor Complex, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. Wang, Y. Peng, T. Zhang, J. Ding
Crystal Structures And Kinetic Studies Of Human Kappa Class Glutathione Transferase Provide Insights Into The Catalytic Mechanism.
Biochem. J. V. 439 215 2011
PubMed-ID: 21728995 | Reference-DOI: 10.1042/BJ20110753

Molecule 1 - GLUTATHIONE S-TRANSFERASE KAPPA 1
	Chains	:	A, B, C, D, E, F
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET22B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GSTK1, HDCMD47P
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GST 13-13, GST CLASS-KAPPA, GSTK1-1, HGSTK1, GLUTATHIONE S- TRANSFERASE SUBUNIT 13

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A			D
Biological Unit 2 (1x)	:		B			E
Biological Unit 3 (1x)	:			C			F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 6)

No.	Name	Count	Type	Full Name
1	GTX	6	Ligand/Ion	S-HEXYLGLUTATHIONE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	GTX	2	Ligand/Ion	S-HEXYLGLUTATHIONE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	GTX	2	Ligand/Ion	S-HEXYLGLUTATHIONE

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	GTX	2	Ligand/Ion	S-HEXYLGLUTATHIONE

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LEU A:15 , SER A:16 , PRO A:17 , TYR A:18 , ILE A:44 , ASN A:53 , PRO A:56 , MET A:66 , LEU A:88 , MET A:91 , PHE A:181 , GLY A:182 , LEU A:183 , PHE A:198 , GLY A:199 , SER A:200 , ASP A:201 , HOH A:269 , HOH A:670 , LYS D:62 , ARG D:202	BINDING SITE FOR RESIDUE GTX A 302
2	AC2	SOFTWARE	LEU B:15 , SER B:16 , PRO B:17 , TYR B:18 , ASN B:53 , PRO B:56 , LEU B:88 , MET B:91 , LEU B:92 , PHE B:181 , GLY B:182 , LEU B:183 , PHE B:198 , GLY B:199 , SER B:200 , ASP B:201 , LYS E:62 , ARG E:202	BINDING SITE FOR RESIDUE GTX B 301
3	AC3	SOFTWARE	LEU C:15 , SER C:16 , PRO C:17 , TYR C:18 , ILE C:44 , ASN C:53 , PRO C:56 , MET C:91 , LEU C:92 , PHE C:181 , GLY C:182 , LEU C:183 , PHE C:198 , GLY C:199 , SER C:200 , ASP C:201 , HOH C:365 , HOH C:426 , LYS F:62 , ARG F:202	BINDING SITE FOR RESIDUE GTX C 301
4	AC4	SOFTWARE	LYS A:62 , ARG A:202 , SER D:16 , PRO D:17 , TYR D:18 , ILE D:44 , ASN D:53 , PRO D:56 , MET D:66 , LEU D:88 , GLY D:182 , LEU D:183 , PHE D:198 , GLY D:199 , SER D:200 , ASP D:201 , HOH D:523 , HOH D:530 , HOH D:593	BINDING SITE FOR RESIDUE GTX D 302
5	AC5	SOFTWARE	LYS B:62 , ARG B:202 , SER E:16 , TYR E:18 , ASN E:53 , MET E:66 , LEU E:88 , GLY E:182 , LEU E:183 , PHE E:198 , GLY E:199 , SER E:200 , ASP E:201 , HOH E:337 , HOH E:695	BINDING SITE FOR RESIDUE GTX E 302
6	AC6	SOFTWARE	LYS C:62 , ARG C:202 , SER F:16 , PRO F:17 , TYR F:18 , ASN F:53 , PRO F:56 , MET F:66 , LEU F:88 , TRP F:126 , GLY F:182 , LEU F:183 , PHE F:198 , GLY F:199 , SER F:200 , ASP F:201 , HOH F:241	BINDING SITE FOR RESIDUE GTX F 302

(no "SS Bond" information available for 3RPN)

Asymmetric Unit

No.	Residues
1	Leu A:183	-	Pro A:184
2	Leu B:183	-	Pro B:184
3	Leu C:183	-	Pro C:184
4	Leu D:183	-	Pro D:184
5	Leu E:183	-	Pro E:184
6	Leu F:183	-	Pro F:184

(no "SAP(SNP)/Variant" information available for 3RPN)

(no "PROSITE Motif" information available for 3RPN)

Asymmetric Unit (8, 48)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3c	ENST00000358406	3c	ENSE00001893107	chr7:142960536-142960678	143	GSTK1_HUMAN	1-24	24	6	A:2-24 B:2-24 C:2-24 D:2-24 E:2-24 F:2-24	23 23 23 23 23 23
1.3i	ENST00000358406	3i	ENSE00002108841	chr7:142961179-142961260	82	GSTK1_HUMAN	25-52	28	6	A:25-52 B:25-52 C:25-52 D:25-52 E:25-52 F:25-52	28 28 28 28 28 28
1.3k	ENST00000358406	3k	ENSE00002119390	chr7:142961641-142961769	129	GSTK1_HUMAN	52-95	44	6	A:52-95 B:52-95 C:52-95 D:52-95 E:52-95 F:52-95	44 44 44 44 44 44
1.3n	ENST00000358406	3n	ENSE00002154510	chr7:142962085-142962185	101	GSTK1_HUMAN	95-128	34	6	A:95-128 B:95-128 C:95-128 D:95-128 E:95-128 F:95-128	34 34 34 34 34 34
1.3p	ENST00000358406	3p	ENSE00000728805	chr7:142962354-142962389	36	GSTK1_HUMAN	129-140	12	6	A:129-140 B:129-140 C:129-140 D:129-140 E:129-140 F:129-140	12 12 12 12 12 12
1.4	ENST00000358406	4	ENSE00002108718	chr7:142964710-142964826	117	GSTK1_HUMAN	141-179	39	6	A:141-179 B:141-179 C:141-179 D:141-179 E:141-179 F:141-179	39 39 39 39 39 39
1.5	ENST00000358406	5	ENSE00002091099	chr7:142965184-142965277	94	GSTK1_HUMAN	180-211	32	6	A:180-211 B:180-211 C:180-211 D:180-211 E:180-211 F:180-211	32 32 32 32 32 32
1.6e	ENST00000358406	6e	ENSE00001789738	chr7:142965881-142966222	342	GSTK1_HUMAN	211-226	16	6	A:211-221 B:211-221 C:211-221 D:211-221 E:211-221 F:211-221	11 11 11 11 11 11

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:220
 aligned with GSTK1_HUMAN | Q9Y2Q3 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:220
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
          GSTK1_HUMAN     2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
               SCOP domains d3rpna_ A: automated matches                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3c  PDB: A:2-24 Exon 1.3i  PDB: A:25-52     ------------------------------------------Exon 1.3n  PDB: A:95-128          Exon 1.3p   Exon 1.4  PDB: A:141-179               Exon 1.5  PDB: A:180-211        ---------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3k  PDB: A:52-95 UniProt: 52-95      -------------------------------------------------------------------------------------------------------------------Exon 1.6e   Transcript 1 (2)
                 3rpn A   2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain B from PDB  Type:PROTEIN  Length:220
 aligned with GSTK1_HUMAN | Q9Y2Q3 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:220
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
          GSTK1_HUMAN     2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
               SCOP domains d3rpnb_ B: automated matches                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3c  PDB: B:2-24 Exon 1.3i  PDB: B:25-52     ------------------------------------------Exon 1.3n  PDB: B:95-128          Exon 1.3p   Exon 1.4  PDB: B:141-179               Exon 1.5  PDB: B:180-211        ---------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3k  PDB: B:52-95 UniProt: 52-95      -------------------------------------------------------------------------------------------------------------------Exon 1.6e   Transcript 1 (2)
                 3rpn B   2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain C from PDB  Type:PROTEIN  Length:220
 aligned with GSTK1_HUMAN | Q9Y2Q3 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:220
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
          GSTK1_HUMAN     2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
               SCOP domains d3rpnc_ C: automated matches                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3c  PDB: C:2-24 Exon 1.3i  PDB: C:25-52     ------------------------------------------Exon 1.3n  PDB: C:95-128          Exon 1.3p   Exon 1.4  PDB: C:141-179               Exon 1.5  PDB: C:180-211        ---------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3k  PDB: C:52-95 UniProt: 52-95      -------------------------------------------------------------------------------------------------------------------Exon 1.6e   Transcript 1 (2)
                 3rpn C   2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain D from PDB  Type:PROTEIN  Length:220
 aligned with GSTK1_HUMAN | Q9Y2Q3 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:220
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
          GSTK1_HUMAN     2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
               SCOP domains d3rpnd_ D: automated matches                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3c  PDB: D:2-24 Exon 1.3i  PDB: D:25-52     ------------------------------------------Exon 1.3n  PDB: D:95-128          Exon 1.3p   Exon 1.4  PDB: D:141-179               Exon 1.5  PDB: D:180-211        ---------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3k  PDB: D:52-95 UniProt: 52-95      -------------------------------------------------------------------------------------------------------------------Exon 1.6e   Transcript 1 (2)
                 3rpn D   2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain E from PDB  Type:PROTEIN  Length:220
 aligned with GSTK1_HUMAN | Q9Y2Q3 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:220
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
          GSTK1_HUMAN     2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
               SCOP domains d3rpne_ E: automated matches                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3c  PDB: E:2-24 Exon 1.3i  PDB: E:25-52     ------------------------------------------Exon 1.3n  PDB: E:95-128          Exon 1.3p   Exon 1.4  PDB: E:141-179               Exon 1.5  PDB: E:180-211        ---------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3k  PDB: E:52-95 UniProt: 52-95      -------------------------------------------------------------------------------------------------------------------Exon 1.6e   Transcript 1 (2)
                 3rpn E   2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain F from PDB  Type:PROTEIN  Length:220
 aligned with GSTK1_HUMAN | Q9Y2Q3 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:220
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
          GSTK1_HUMAN     2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
               SCOP domains d3rpnf_ F: automated matches                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3c  PDB: F:2-24 Exon 1.3i  PDB: F:25-52     ------------------------------------------Exon 1.3n  PDB: F:95-128          Exon 1.3p   Exon 1.4  PDB: F:141-179               Exon 1.5  PDB: F:180-211        ---------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3k  PDB: F:52-95 UniProt: 52-95      -------------------------------------------------------------------------------------------------------------------Exon 1.6e   Transcript 1 (2)
                 3rpn F   2 GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA 221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: DsbA-like (29)

Protein domain: automated matches (10)

Human (Homo sapiens) [TaxId: 9606] (3)

1a	d3rpna_	A:
1b	d3rpnb_	B:
1c	d3rpnc_	C:
1d	d3rpnd_	D:
1e	d3rpne_	E:
1f	d3rpnf_	F:

(no "CATH Domain" information available for 3RPN)

(no "Pfam Domain" information available for 3RPN)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (GSTK1_HUMAN | Q9Y2Q3)

molecular function
	GO:0004602	glutathione peroxidase activity	Catalysis of the reaction: 2 glutathione + hydrogen peroxide = oxidized glutathione + 2 H2O.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0098869	cellular oxidant detoxification	Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005777	peroxisome	A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GTX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:183 - Pro A:184	[ RasMol ]
		Leu B:183 - Pro B:184	[ RasMol ]
		Leu C:183 - Pro C:184	[ RasMol ]
		Leu D:183 - Pro D:184	[ RasMol ]
		Leu E:183 - Pro E:184	[ RasMol ]
		Leu F:183 - Pro F:184	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3rpn
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GSTK1_HUMAN \| Q9Y2Q3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GSTK1_HUMAN \| Q9Y2Q3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GSTK1_HUMAN \| Q9Y2Q3	:	1yzx 3rpp

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (8, 48)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (19, 19)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File