3R9E - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF MICROCIN C7 SELF IMMUNITY ACETYLTRANSFERASE MCCE IN COMPLEX WITH COENZYME A AND ASPARTYL SULFAMOYL ADENOSINE (DSA)

Authors :   S. K. Nair, V. Agarwal

Date :   25 Mar 11 (Deposition) - 20 Apr 11 (Release) - 29 Jun 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.25

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Microcin C7, Acetyltransferase, Self Immunity, Resistance, Acetyl Coenzyme A, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   V. Agarwal, A. Metlitskaya, K. Severinov, S. K. Nair
Structural Basis For Microcin C7 Inactivation By The Mcce Acetyltransferase.
J. Biol. Chem. V. 286 21295 2011
PubMed-ID: 21507941 | Reference-DOI: 10.1074/JBC.M111.226282

Molecule 1 - MCCE PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28
	Expression System Strain	:	ROSETTA2(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	MCCE
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	COA	2	Ligand/Ion	COENZYME A
2	DSZ	2	Ligand/Ion	5'-O-(L-ALPHA-ASPARTYLSULFAMOYL)ADENOSINE

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A
2	DSZ	1	Ligand/Ion	5'-O-(L-ALPHA-ASPARTYLSULFAMOYL)ADENOSINE

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A
2	DSZ	1	Ligand/Ion	5'-O-(L-ALPHA-ASPARTYLSULFAMOYL)ADENOSINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:45 , TYR A:105 , TRP A:106 , LEU A:107 , GLN A:112 , GLY A:113 , LYS A:114 , GLY A:115 , ILE A:116 , VAL A:117 , THR A:118 , ASN A:119 , CYS A:141 , ASN A:145 , LYS A:147 , THR A:151 , ARG A:154 , HOH A:185 , HOH A:189 , HOH A:243 , HOH A:254 , HOH A:262 , HOH A:273 , HOH A:274 , HOH A:308 , HOH A:368 , HOH A:458 , DSZ A:500 , HOH A:682 , ARG B:154 , HOH B:334 , COA B:400	BINDING SITE FOR RESIDUE COA A 400
2	AC2	SOFTWARE	MET A:46 , TRP A:48 , PHE A:61 , VAL A:88 , SER A:90 , ASN A:92 , GLY A:104 , TYR A:105 , TRP A:106 , LYS A:140 , CYS A:141 , GLU A:167 , GLN A:176 , HOH A:203 , HOH A:209 , HOH A:230 , HOH A:262 , HOH A:297 , HOH A:302 , HOH A:320 , HOH A:338 , COA A:400 , HOH A:590 , HOH A:613	BINDING SITE FOR RESIDUE DSZ A 500
3	AC3	SOFTWARE	COA A:400 , SER B:45 , TYR B:105 , TRP B:106 , LEU B:107 , GLN B:112 , GLY B:113 , LYS B:114 , GLY B:115 , ILE B:116 , VAL B:117 , THR B:118 , LYS B:140 , CYS B:141 , ASN B:145 , LYS B:147 , SER B:148 , THR B:151 , ARG B:154 , HOH B:188 , HOH B:191 , HOH B:209 , HOH B:212 , HOH B:233 , HOH B:238 , HOH B:282 , HOH B:401 , HOH B:418 , DSZ B:500 , HOH B:546 , HOH B:550 , HOH B:681	BINDING SITE FOR RESIDUE COA B 400
4	AC4	SOFTWARE	TRP B:48 , PHE B:61 , VAL B:88 , SER B:90 , ASN B:92 , GLY B:104 , TYR B:105 , TRP B:106 , LYS B:140 , GLU B:167 , GLN B:176 , HOH B:270 , HOH B:286 , HOH B:294 , HOH B:370 , HOH B:384 , HOH B:387 , COA B:400	BINDING SITE FOR RESIDUE DSZ B 500

(no "SS Bond" information available for 3R9E)

(no "Cis Peptide Bond" information available for 3R9E)

(no "SAP(SNP)/Variant" information available for 3R9E)

(no "PROSITE Motif" information available for 3R9E)

(no "Exon" information available for 3R9E)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:180
 aligned with Q47510_ECOLX | Q47510 from UniProtKB/TrEMBL  Length:521

    Alignment length:180
                                   350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520
         Q47510_ECOLX   341 DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI 520
               SCOP domains d3r9ea_ A: automated matches                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee..eee....eeee..hhhhhhhhhhhhhhhhhhhhh..hhhhhh.hhhhhhhhhhhhhhhhhh...eeeeeee..eeeeeeeeeeee....eeeeeeee.hhhh..hhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3r9e A   4 DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI 183
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183

Chain B from PDB  Type:PROTEIN  Length:180
 aligned with Q47510_ECOLX | Q47510 from UniProtKB/TrEMBL  Length:521

    Alignment length:180
                                   350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520
         Q47510_ECOLX   341 DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI 520
               SCOP domains d3r9eb_ B: automated matches                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------Acetyltransf_1-3r9eB01 B:79-158                                                 ------------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------Acetyltransf_1-3r9eB02 B:79-158                                                 ------------------------- Pfam domains (2)
         Sec.struct. author .......eee....eeee..hhhhhhhhhhhhhhhhhhhh...hhhhhh.hhhhhhhhhhhhhhhhhh...eeeeeee..eeeeeeeeeeee....eeeeeeee.hhhh..hhhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3r9e B   4 DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI 183
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Acyl-CoA N-acyltransferases (Nat) (250)

Superfamily: Acyl-CoA N-acyltransferases (Nat) (250)

Family: automated matches (63)

Protein domain: automated matches (63)

Escherichia coli [TaxId: 562] (5)

1a	d3r9ea_	A:
1b	d3r9eb_	B:

(no "CATH Domain" information available for 3R9E)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Acetyltrans (109)

Family: Acetyltransf_1 (58)

Escherichia coli (5)

1a	Acetyltransf_1-3r9eB01	B:79-158
1b	Acetyltransf_1-3r9eB02	B:79-158

Asymmetric Unit(hide GO term definitions)

Chain A,B (Q47510_ECOLX | Q47510)


GO:0008080	N-acetyltransferase activity	Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		DSZ	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3r9e)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3r9e
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q47510_ECOLX \| Q47510
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q47510_ECOLX \| Q47510
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	Q47510_ECOLX \| Q47510	:	3r95 3r96 3r9f 3r9g

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (3, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File