3QZT - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF BPTF BROMO IN COMPLEX WITH HISTONE H4K16AC - FORM II

Authors :   H. Li, A. J. Ruthenburg, D. J. Patel

Date :   07 Mar 11 (Deposition) - 01 Jun 11 (Release) - 15 Jun 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.50

Chains :   Asym./Biol. Unit : A,B

Keywords :   Protein-Peptide Complex, All Alpha Helix, Transcription, Histone H4, Nuclear, Transcription-Nuclear Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. J. Ruthenburg, H. Li, T. A. Milne, S. Dewell, R. K. Mcginty, M. Yuen, B. Ueberheide, Y. Dou, T. W. Muir, D. J. Patel, C. D. Allis
Recognition Of A Mononucleosomal Histone Modification Pattern By Bptf Via Multivalent Interactions.
Cell(Cambridge, Mass. ) V. 145 692 2011
PubMed-ID: 21596426 | Reference-DOI: 10.1016/J.CELL.2011.03.053

Molecule 1 - NUCLEOSOME-REMODELING FACTOR SUBUNIT BPTF
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX6P
	Expression System Strain	:	ROSSETA2
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	BROMODOMAIN (UNP RESIDUES 2924-3037)
	Gene	:	BPTF, FAC1, FALZ
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	BROMODOMAIN AND PHD FINGER-CONTAINING TRANSCRIPTION FACTOR, FETAL ALZ-50 CLONE 1 PROTEIN, FETAL ALZHEIMER ANTIGEN

Molecule 2 - HISTONE H4
	Chains	:	B
	Engineered	:	YES
	Organism Common	:	CLAWED FROG,COMMON PLATANNA,PLATANNA
	Organism Scientific	:	XENOPUS LAEVIS
	Organism Taxid	:	8355
	Other Details	:	THIS SEQUENCE OCCURS NATURALLY IN HUMANS
	Synthetic	:	YES

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 2)

No.	Name	Count	Type	Full Name
1	ALY	1	Mod. Amino Acid	N(6)-ACETYLLYSINE
2	GOL	1	Ligand/Ion	GLYCEROL

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:109 , LYS A:110 , TYR A:146 , TYR A:155 , HOH A:176 , HOH A:202 , HOH A:211 , HOH A:220 , HOH A:242	BINDING SITE FOR RESIDUE GOL A 1

(no "SS Bond" information available for 3QZT)

(no "Cis Peptide Bond" information available for 3QZT)

(no "SAP(SNP)/Variant" information available for 3QZT)

Asymmetric/Biological Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HISTONE_H4	PS00047	Histone H4 signature.	H4_HUMAN	15-19	1	B:14-18
2	BROMODOMAIN_2	PS50014	Bromodomain profile.	BPTF_HUMAN	2944-3014	1	A:85-155
3	BROMODOMAIN_1	PS00633	Bromodomain signature.	BPTF_HUMAN	2949-3006	1	A:90-147

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000321892	1c	ENSE00001357454	chr17:65821780-65822453	674	BPTF_HUMAN	1-205	205	0	-	-
1.2	ENST00000321892	2	ENSE00001148014	chr17:65850056-65850878	823	BPTF_HUMAN	205-479	275	0	-	-
1.3	ENST00000321892	3	ENSE00001148007	chr17:65862580-65862803	224	BPTF_HUMAN	479-554	76	0	-	-
1.4	ENST00000321892	4	ENSE00001147999	chr17:65870933-65871136	204	BPTF_HUMAN	554-622	69	0	-	-
1.5	ENST00000321892	5	ENSE00001147993	chr17:65871672-65871860	189	BPTF_HUMAN	622-685	64	0	-	-
1.7	ENST00000321892	7	ENSE00001147984	chr17:65882244-65882432	189	BPTF_HUMAN	685-748	64	0	-	-
1.8	ENST00000321892	8	ENSE00001147980	chr17:65887960-65888150	191	BPTF_HUMAN	748-811	64	0	-	-
1.9	ENST00000321892	9	ENSE00001223583	chr17:65889486-65889841	356	BPTF_HUMAN	812-930	119	0	-	-
1.10	ENST00000321892	10	ENSE00001612408	chr17:65890150-65890281	132	BPTF_HUMAN	930-974	45	0	-	-
1.11	ENST00000321892	11	ENSE00002166039	chr17:65899905-65900034	130	BPTF_HUMAN	974-1017	44	0	-	-
1.12	ENST00000321892	12	ENSE00001750925	chr17:65900818-65900956	139	BPTF_HUMAN	1018-1064	47	0	-	-
1.13	ENST00000321892	13	ENSE00001665602	chr17:65905698-65905877	180	BPTF_HUMAN	1064-1124	61	0	-	-
1.14	ENST00000321892	14	ENSE00001606591	chr17:65906993-65909303	2311	BPTF_HUMAN	1124-1894	771	0	-	-
1.15	ENST00000321892	15	ENSE00001657056	chr17:65914830-65914954	125	BPTF_HUMAN	1894-1936	43	0	-	-
1.16	ENST00000321892	16	ENSE00001625445	chr17:65916131-65916259	129	BPTF_HUMAN	1936-1979	44	0	-	-
1.17	ENST00000321892	17	ENSE00001642854	chr17:65918956-65919106	151	BPTF_HUMAN	1979-2029	51	0	-	-
1.18	ENST00000321892	18	ENSE00001783568	chr17:65920663-65920705	43	BPTF_HUMAN	2029-2043	15	0	-	-
1.19	ENST00000321892	19	ENSE00001604847	chr17:65924471-65924717	247	BPTF_HUMAN	2044-2126	83	0	-	-
1.20	ENST00000321892	20	ENSE00001680408	chr17:65925452-65925603	152	BPTF_HUMAN	2126-2176	51	0	-	-
1.21	ENST00000321892	21	ENSE00001779718	chr17:65928027-65928135	109	BPTF_HUMAN	2177-2213	37	0	-	-
1.22	ENST00000321892	22	ENSE00001770472	chr17:65936555-65936772	218	BPTF_HUMAN	2213-2285	73	0	-	-
1.23a	ENST00000321892	23a	ENSE00001733774	chr17:65940266-65940488	223	BPTF_HUMAN	2286-2360	75	0	-	-
1.24c	ENST00000321892	24c	ENSE00001223457	chr17:65941525-65942441	917	BPTF_HUMAN	2360-2665	306	0	-	-
1.25	ENST00000321892	25	ENSE00001603899	chr17:65943842-65943924	83	BPTF_HUMAN	2666-2693	28	0	-	-
1.26	ENST00000321892	26	ENSE00001707553	chr17:65944197-65944422	226	BPTF_HUMAN	2693-2768	76	0	-	-
1.27a	ENST00000321892	27a	ENSE00001743235	chr17:65955657-65955991	335	BPTF_HUMAN	2769-2880	112	0	-	-
1.29	ENST00000321892	29	ENSE00001707648	chr17:65960328-65960520	193	BPTF_HUMAN	2880-2944	65	1	A:66-85	20
1.30	ENST00000321892	30	ENSE00001598996	chr17:65962688-65962772	85	BPTF_HUMAN	2945-2973	29	1	A:86-114	29
1.31	ENST00000321892	31	ENSE00001755666	chr17:65971888-65972074	187	BPTF_HUMAN	2973-3035	63	1	A:114-173	60
1.32c	ENST00000321892	32c	ENSE00001766345	chr17:65978368-65980494	2127	BPTF_HUMAN	3035-3046	12	0	-	-

2.1	ENST00000377803	1	ENSE00001475159	chr6:26104104-26104518	415	H4_HUMAN	1-127	127	1	B:14-19	6

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:108
 aligned with BPTF_HUMAN | Q12830 from UniProtKB/Swiss-Prot  Length:3046

    Alignment length:108
                                  2934      2944      2954      2964      2974      2984      2994      3004      3014      3024        
          BPTF_HUMAN   2925 LTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK 3032
               SCOP domains d3qzta_ A: automated matches                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -----------Bromodomain-3qztA01 A:77-160                                                        ------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhh..hhhhh...hhhhh.hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -------------------BROMODOMAIN_2  PDB: A:85-155 UniProt: 2944-3014                        ------------------ PROSITE (1)
                PROSITE (2) ------------------------BROMODOMAIN_1  PDB: A:90-147 UniProt: 2949-3006           -------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.29           Exon 1.30  PDB: A:86-114     ----------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------Exon 1.31  PDB: A:114-173 UniProt: 2973-3035 [INCOMPLETE]    Transcript 1 (2)
                3qzt A   66 LTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK  173
                                    75        85        95       105       115       125       135       145       155       165

Chain B from PDB  Type:PROTEIN  Length:6
 aligned with H4_HUMAN | P62805 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:6
            H4_HUMAN     15 GAKRHR   20
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE HISTO- PROSITE
               Transcript 2 2.1    Transcript 2
                3qzt B   14 GAkRHR   19
                              |   
                             16-ALY

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Bromodomain-like (339)

Superfamily: Bromodomain (203)

Family: automated matches (169)

Protein domain: automated matches (169)

Human (Homo sapiens) [TaxId: 9606] (162)

d3qzta_

(no "CATH Domain" information available for 3QZT)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Bromodomain] (56)

Family: Bromodomain (56)

Homo sapiens (Human) (44)

Bromodomain-3qztA01

A:77-160

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (BPTF_HUMAN | Q12830)

molecular function
	GO:0008094	DNA-dependent ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of single- or double-stranded DNA, and it drives another reaction.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0009952	anterior/posterior pattern specification	The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
	GO:0007420	brain development	The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
	GO:1990090	cellular response to nerve growth factor stimulus	A process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nerve growth factor stimulus.
	GO:0006338	chromatin remodeling	Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
	GO:0001892	embryonic placenta development	The embryonically driven process whose specific outcome is the progression of the placenta over time, from its formation to the mature structure. The placenta is an organ of metabolic interchange between fetus and mother, partly of embryonic origin and partly of maternal origin.
	GO:0007492	endoderm development	The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0009611	response to wounding	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0016589	NURF complex	An ISWI complex that contains an ATPase subunit of the ISWI family (SNF2L in mammals), a NURF301 homolog (BPTF in humans), and additional subunits, though the composition of these additional subunits varies slightly with species. NURF is involved in regulation of transcription from TRNA polymerase II promoters.
	GO:0044297	cell body	The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Chain B (H4_HUMAN | P62805)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
	GO:0034080	CENP-A containing nucleosome assembly	The formation of nucleosomes containing the histone H3 variant CENP-A to form centromeric chromatin. This specialised chromatin occurs at centromeric region in point centromeres, and the central core in modular centromeres.
	GO:0006335	DNA replication-dependent nucleosome assembly	The formation of nucleosomes on newly replicated DNA, coupled to strand elongation.
	GO:0006336	DNA replication-independent nucleosome assembly	The formation of nucleosomes outside the context of DNA replication.
	GO:0006352	DNA-templated transcription, initiation	Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
	GO:1904837	beta-catenin-TCF complex assembly	The aggregation, arrangement and bonding together of a set of components to form a beta-catenin-TCF complex.
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0000183	chromatin silencing at rDNA	Repression of transcription of ribosomal DNA by altering the structure of chromatin.
	GO:0006303	double-strand break repair via nonhomologous end joining	The repair of a double-strand break in DNA in which the two broken ends are rejoined with little or no sequence complementarity. Information at the DNA ends may be lost due to the modification of broken DNA ends. This term covers instances of separate pathways, called classical (or canonical) and alternative nonhomologous end joining (C-NHEJ and A-NHEJ). These in turn may further branch into sub-pathways, but evidence is still unclear.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0045814	negative regulation of gene expression, epigenetic	Any epigenetic process that stops, prevents or reduces the rate of gene expression.
	GO:0045653	negative regulation of megakaryocyte differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of megakaryocyte differentiation.
	GO:0006334	nucleosome assembly	The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
	GO:0045815	positive regulation of gene expression, epigenetic	Any epigenetic process that activates or increases the rate of gene expression.
	GO:0051290	protein heterotetramerization	The formation of a protein heterotetramer, a macromolecular structure consisting of four noncovalently associated subunits, of which not all are identical.
	GO:0016233	telomere capping	A process in which telomeres are protected from degradation and fusion, thereby ensuring chromosome stability by protecting the ends from both degradation and from being recognized as damaged DNA. May be mediated by specific single- or double-stranded telomeric DNA binding proteins.
	GO:0032200	telomere organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of telomeres, terminal regions of a linear chromosome that include the telomeric DNA repeats and associated proteins.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0000228	nuclear chromosome	A chromosome that encodes the nuclear genome and is found in the nucleus of a eukaryotic cell during the cell cycle phases when the nucleus is intact.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0000786	nucleosome	A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ALY	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3qzt)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3qzt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BPTF_HUMAN \| Q12830
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H4_HUMAN \| P62805
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BPTF_HUMAN \| Q12830
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	H4_HUMAN \| P62805
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

3qzs	H4K16AC COMPLEX P21 SPACE GROUP
3qzv	H4K12AC COMPLEX

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 3)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (53, 57)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File