Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BPTF BROMO IN COMPLEX WITH HISTONE H4K16AC - FORM I
 
Authors :  H. Li, A. J. Ruthenburg, D. J. Patel
Date :  07 Mar 11  (Deposition) - 01 Jun 11  (Release) - 15 Jun 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Protein-Peptide Complex, Transcription-Nuclear Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. J. Ruthenburg, H. Li, T. A. Milne, S. Dewell, R. K. Mcginty, M. Yuen, B. Ueberheide, Y. Dou, T. W. Muir, D. J. Patel, C. D. Allis
Recognition Of A Mononucleosomal Histone Modification Pattern By Bptf Via Multivalent Interactions.
Cell(Cambridge, Mass. ) V. 145 692 2011
PubMed-ID: 21596426  |  Reference-DOI: 10.1016/J.CELL.2011.03.053

(-) Compounds

Molecule 1 - NUCLEOSOME-REMODELING FACTOR SUBUNIT BPTF
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PGEX6P
    Expression System Strain: ROSSETA2
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: BPTF, FAC1, FALZ
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: BROMODOMAIN AND PHD FINGER-CONTAINING TRANSCRIPTION FACTOR, FETAL ALZ-50 CLONE 1 PROTEIN, FETAL ALZHEIMER ANTIGEN
 
Molecule 2 - HISTONE H4
    Chains: C, D
    Engineered: YES
    Organism Common: CLAWED FROG,COMMON PLATANNA,PLATANNA
    Organism Scientific: XENOPUS LAEVIS
    Organism Taxid: 8355
    Other Details: HUMAN HISTONE H4 12-21
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1ALY2Mod. Amino AcidN(6)-ACETYLLYSINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1ALY1Mod. Amino AcidN(6)-ACETYLLYSINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1ALY1Mod. Amino AcidN(6)-ACETYLLYSINE

(-) Sites  (0, 0)

(no "Site" information available for 3QZS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3QZS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3QZS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QZS)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H4PS00047 Histone H4 signature.H4_HUMAN15-19
 		  2C:14-18
D:14-18
2BROMODOMAIN_2PS50014 Bromodomain profile.BPTF_HUMAN2944-3014
 		  2A:85-155
B:85-155
3BROMODOMAIN_1PS00633 Bromodomain signature.BPTF_HUMAN2949-3006
 		  2A:90-147
B:90-147
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H4PS00047 Histone H4 signature.H4_HUMAN15-19
 		  1C:14-18
-
2BROMODOMAIN_2PS50014 Bromodomain profile.BPTF_HUMAN2944-3014
 		  1A:85-155
-
3BROMODOMAIN_1PS00633 Bromodomain signature.BPTF_HUMAN2949-3006
 		  1A:90-147
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H4PS00047 Histone H4 signature.H4_HUMAN15-19
 		  1-
D:14-18
2BROMODOMAIN_2PS50014 Bromodomain profile.BPTF_HUMAN2944-3014
 		  1-
B:85-155
3BROMODOMAIN_1PS00633 Bromodomain signature.BPTF_HUMAN2949-3006
 		  1-
B:90-147

(-) Exons   (4, 8)

Asymmetric Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000003218921cENSE00001357454chr17:65821780-65822453674BPTF_HUMAN1-2052050--
1.2ENST000003218922ENSE00001148014chr17:65850056-65850878823BPTF_HUMAN205-4792750--
1.3ENST000003218923ENSE00001148007chr17:65862580-65862803224BPTF_HUMAN479-554760--
1.4ENST000003218924ENSE00001147999chr17:65870933-65871136204BPTF_HUMAN554-622690--
1.5ENST000003218925ENSE00001147993chr17:65871672-65871860189BPTF_HUMAN622-685640--
1.7ENST000003218927ENSE00001147984chr17:65882244-65882432189BPTF_HUMAN685-748640--
1.8ENST000003218928ENSE00001147980chr17:65887960-65888150191BPTF_HUMAN748-811640--
1.9ENST000003218929ENSE00001223583chr17:65889486-65889841356BPTF_HUMAN812-9301190--
1.10ENST0000032189210ENSE00001612408chr17:65890150-65890281132BPTF_HUMAN930-974450--
1.11ENST0000032189211ENSE00002166039chr17:65899905-65900034130BPTF_HUMAN974-1017440--
1.12ENST0000032189212ENSE00001750925chr17:65900818-65900956139BPTF_HUMAN1018-1064470--
1.13ENST0000032189213ENSE00001665602chr17:65905698-65905877180BPTF_HUMAN1064-1124610--
1.14ENST0000032189214ENSE00001606591chr17:65906993-659093032311BPTF_HUMAN1124-18947710--
1.15ENST0000032189215ENSE00001657056chr17:65914830-65914954125BPTF_HUMAN1894-1936430--
1.16ENST0000032189216ENSE00001625445chr17:65916131-65916259129BPTF_HUMAN1936-1979440--
1.17ENST0000032189217ENSE00001642854chr17:65918956-65919106151BPTF_HUMAN1979-2029510--
1.18ENST0000032189218ENSE00001783568chr17:65920663-6592070543BPTF_HUMAN2029-2043150--
1.19ENST0000032189219ENSE00001604847chr17:65924471-65924717247BPTF_HUMAN2044-2126830--
1.20ENST0000032189220ENSE00001680408chr17:65925452-65925603152BPTF_HUMAN2126-2176510--
1.21ENST0000032189221ENSE00001779718chr17:65928027-65928135109BPTF_HUMAN2177-2213370--
1.22ENST0000032189222ENSE00001770472chr17:65936555-65936772218BPTF_HUMAN2213-2285730--
1.23aENST0000032189223aENSE00001733774chr17:65940266-65940488223BPTF_HUMAN2286-2360750--
1.24cENST0000032189224cENSE00001223457chr17:65941525-65942441917BPTF_HUMAN2360-26653060--
1.25ENST0000032189225ENSE00001603899chr17:65943842-6594392483BPTF_HUMAN2666-2693280--
1.26ENST0000032189226ENSE00001707553chr17:65944197-65944422226BPTF_HUMAN2693-2768760--
1.27aENST0000032189227aENSE00001743235chr17:65955657-65955991335BPTF_HUMAN2769-28801120--
1.29ENST0000032189229ENSE00001707648chr17:65960328-65960520193BPTF_HUMAN2880-2944652A:64-85
B:64-85		22
22
1.30ENST0000032189230ENSE00001598996chr17:65962688-6596277285BPTF_HUMAN2945-2973292A:86-114
B:86-114		29
29
1.31ENST0000032189231ENSE00001755666chr17:65971888-65972074187BPTF_HUMAN2973-3035632A:114-174
B:114-174		61
61
1.32cENST0000032189232cENSE00001766345chr17:65978368-659804942127BPTF_HUMAN3035-3046120--
2.1ENST000003778031ENSE00001475159chr6:26104104-26104518415H4_HUMAN1-1271272C:14-21
D:14-21		8
8

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with BPTF_HUMAN | Q12830 from UniProtKB/Swiss-Prot  Length:3046

    Alignment length:111
                                  2932      2942      2952      2962      2972      2982      2992      3002      3012      3022      3032 
          BPTF_HUMAN   2923 TVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA 3033
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------BROMODOMAIN_2  PDB: A:85-155 UniProt: 2944-3014                        ------------------- PROSITE (1)
                PROSITE (2) --------------------------BROMODOMAIN_1  PDB: A:90-147 UniProt: 2949-3006           --------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.29  PDB: A:64-8Exon 1.30  PDB: A:86-114     ------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.31  PDB: A:114-174 UniProt: 2973-3035 [INCOMPLETE]     Transcript 1 (2)
                3qzs A   64 SVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTAIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA  174
                                    73        83        93       103       113       123       133       143       153       163       173 


Chain B from PDB  Type:PROTEIN  Length:111
 aligned with BPTF_HUMAN | Q12830 from UniProtKB/Swiss-Prot  Length:3046

    Alignment length:111
                                  2932      2942      2952      2962      2972      2982      2992      3002      3012      3022      3032 
          BPTF_HUMAN   2923 TVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA 3033
               SCOP domains d3qzsb_ B: automated matches                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------Bromodomain-3qzsB01 B:77-160                                                        -------------- Pfam domains (1)
           Pfam domains (2) -------------Bromodomain-3qzsB02 B:77-160                                                        -------------- Pfam domains (2)
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------BROMODOMAIN_2  PDB: B:85-155 UniProt: 2944-3014                        ------------------- PROSITE (1)
                PROSITE (2) --------------------------BROMODOMAIN_1  PDB: B:90-147 UniProt: 2949-3006           --------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.29  PDB: B:64-8Exon 1.30  PDB: B:86-114     ------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.31  PDB: B:114-174 UniProt: 2973-3035 [INCOMPLETE]     Transcript 1 (2)
                3qzs B   64 SVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTAIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA  174
                                    73        83        93       103       113       123       133       143       153       163       173 


Chain C from PDB  Type:PROTEIN  Length:8
 aligned with H4_HUMAN | P62805 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:8
            H4_HUMAN     15 GAKRHRKV   22
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE HISTO--- PROSITE
               Transcript 2 Exon 2.1 Transcript 2
                3qzs C   14 GAkRHRKV   21
                              |     
                             16-ALY 


Chain D from PDB  Type:PROTEIN  Length:8
 aligned with H4_HUMAN | P62805 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:8
            H4_HUMAN     15 GAKRHRKV   22
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE HISTO--- PROSITE
               Transcript 2 Exon 2.1 Transcript 2
                3qzs D   14 GAkRHRKV   21
                              |     
                             16-ALY
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QZS)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: Bromodomain] (56)

(-) Gene Ontology  (53, 57)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (BPTF_HUMAN | Q12830)
molecular function
    GO:0008094    DNA-dependent ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of single- or double-stranded DNA, and it drives another reaction.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0009952    anterior/posterior pattern specification    The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:1990090    cellular response to nerve growth factor stimulus    A process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nerve growth factor stimulus.
    GO:0006338    chromatin remodeling    Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
    GO:0001892    embryonic placenta development    The embryonically driven process whose specific outcome is the progression of the placenta over time, from its formation to the mature structure. The placenta is an organ of metabolic interchange between fetus and mother, partly of embryonic origin and partly of maternal origin.
    GO:0007492    endoderm development    The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0016589    NURF complex    An ISWI complex that contains an ATPase subunit of the ISWI family (SNF2L in mammals), a NURF301 homolog (BPTF in humans), and additional subunits, though the composition of these additional subunits varies slightly with species. NURF is involved in regulation of transcription from TRNA polymerase II promoters.
    GO:0044297    cell body    The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.

Chain C,D   (H4_HUMAN | P62805)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0042393    histone binding    Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
    GO:0034080    CENP-A containing nucleosome assembly    The formation of nucleosomes containing the histone H3 variant CENP-A to form centromeric chromatin. This specialised chromatin occurs at centromeric region in point centromeres, and the central core in modular centromeres.
    GO:0006335    DNA replication-dependent nucleosome assembly    The formation of nucleosomes on newly replicated DNA, coupled to strand elongation.
    GO:0006336    DNA replication-independent nucleosome assembly    The formation of nucleosomes outside the context of DNA replication.
    GO:0006352    DNA-templated transcription, initiation    Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
    GO:1904837    beta-catenin-TCF complex assembly    The aggregation, arrangement and bonding together of a set of components to form a beta-catenin-TCF complex.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0000183    chromatin silencing at rDNA    Repression of transcription of ribosomal DNA by altering the structure of chromatin.
    GO:0006303    double-strand break repair via nonhomologous end joining    The repair of a double-strand break in DNA in which the two broken ends are rejoined with little or no sequence complementarity. Information at the DNA ends may be lost due to the modification of broken DNA ends. This term covers instances of separate pathways, called classical (or canonical) and alternative nonhomologous end joining (C-NHEJ and A-NHEJ). These in turn may further branch into sub-pathways, but evidence is still unclear.
    GO:0031047    gene silencing by RNA    Any process in which RNA molecules inactivate expression of target genes.
    GO:0045814    negative regulation of gene expression, epigenetic    Any epigenetic process that stops, prevents or reduces the rate of gene expression.
    GO:0045653    negative regulation of megakaryocyte differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of megakaryocyte differentiation.
    GO:0006334    nucleosome assembly    The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
    GO:0045815    positive regulation of gene expression, epigenetic    Any epigenetic process that activates or increases the rate of gene expression.
    GO:0051290    protein heterotetramerization    The formation of a protein heterotetramer, a macromolecular structure consisting of four noncovalently associated subunits, of which not all are identical.
    GO:0016233    telomere capping    A process in which telomeres are protected from degradation and fusion, thereby ensuring chromosome stability by protecting the ends from both degradation and from being recognized as damaged DNA. May be mediated by specific single- or double-stranded telomeric DNA binding proteins.
    GO:0032200    telomere organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of telomeres, terminal regions of a linear chromosome that include the telomeric DNA repeats and associated proteins.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0000228    nuclear chromosome    A chromosome that encodes the nuclear genome and is found in the nucleus of a eukaryotic cell during the cell cycle phases when the nucleus is intact.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0000786    nucleosome    A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ALY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3qzs)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3qzs)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qzs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BPTF_HUMAN | Q12830
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  H4_HUMAN | P62805
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BPTF_HUMAN | Q12830
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  H4_HUMAN | P62805
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BPTF_HUMAN | Q12830: 2f6j 2f6n 2fsa 2fui 2fuu 2ri7 3qzt 3qzv 3uv2
        H4_HUMAN | P62805: 1kx4 1kx5 1m18 1m19 1m1a 1s32 1zkk 2bqz 2cv5 2ig0 2kwn 2kwo 2lvm 2qqs 2rje 2rny 2rs9 3a6n 3afa 3an2 3av1 3av2 3ayw 3aze 3azf 3azg 3azh 3azi 3azj 3azk 3azl 3azm 3azn 3cfs 3cfv 3f9w 3f9x 3f9y 3f9z 3ij1 3jpx 3nqj 3nqu 3o36 3qby 3qzt 3qzv 3r45 3uvw 3uvx 3uvy 3uw9 3w96 3w97 3w98 3w99 3wa9 3waa 3wkj 3wtp 3x1s 3x1t 3x1u 3x1v 4gqb 4h9n 4h9o 4h9p 4h9q 4h9r 4h9s 4hga 4m38 4n3w 4n4f 4qut 4quu 4qyd 4u9w 4ym5 4ym6 4yy6 4yyd 4yyg 4yyh 4yyi 4yyj 4yyk 4yym 4yyn 4z2m 4z5t 5av5 5av6 5av8 5av9 5avb 5avc 5ay8 5b0y 5b0z 5b24 5b2i 5b2j 5b31 5b32 5b33 5b40 5bnv 5bnx 5bo0 5c3i 5cpi 5cpj 5cpk 5fa5 5ffw 5fwe 5gse 5gsu 5gt0 5gt3 5gtc 5gxq 5ja4 5jrg 5kdm 5teg 5x7x

(-) Related Entries Specified in the PDB File

3qzt H4K16AC COMPLEX C2 SPACE GROUP
3qzv H4K12AC COMPLEX