|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3QUW) |
Sites (0, 0)| (no "Site" information available for 3QUW) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3QUW) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3QUW) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3QUW) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3QUW) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:125 aligned with MMF1_YEAST | P40185 from UniProtKB/Swiss-Prot Length:145 Alignment length:125 29 39 49 59 69 79 89 99 109 119 129 139 MMF1_YEAST 20 TLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIAVEK 144 SCOP domains d3quwa_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------Ribonuc_L-PSP-3quwA01 A:26-143 - Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------UPF0076 ------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 3quw A 20 TLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIAVEK 144 29 39 49 59 69 79 89 99 109 119 129 139
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3QUW) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (MMF1_YEAST | P40185)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|