3QB7 - JenaLib

Asymmetric Unit (31, 62)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_020392	C	27	R	IL4_HUMAN	Polymorphism	4986964	A/B	C	3	R
02	UniProt	VAR_002669	C	62	G	IL2RG_HUMAN	Disease (XSCID)	---	C/D	C	40	G
03	UniProt	VAR_002670	E	68	G	IL2RG_HUMAN	Disease (XSCID)	---	C/D	E	46	G
04	UniProt	VAR_002671	E	68	K	IL2RG_HUMAN	Disease (XSCID)	---	C/D	E	46	K
05	UniProt	VAR_002672	N	84	K	IL2RG_HUMAN	Disease (XSCID)	---	C/D	N	62	K
06	UniProt	VAR_002673	Y	89	C	IL2RG_HUMAN	Disease (XSCID)	---	C/D	Y	67	C
07	UniProt	VAR_002674	Y	105	C	IL2RG_HUMAN	Disease (XSCID)	193922347	C/D	Y	83	C
08	UniProt	VAR_020611	E	109	K	IL2RG_HUMAN	Polymorphism	17875899	C/D	E	87	K
09	UniProt	VAR_002675	G	114	D	IL2RG_HUMAN	Disease (XSCID)	111033620	C/D	G	92	D
10	UniProt	VAR_002676	C	115	F	IL2RG_HUMAN	Disease (XSCID)	---	C/D	C	93	F
11	UniProt	VAR_002677	C	115	R	IL2RG_HUMAN	Disease (XSCID)	111033622	C/D	C	93	R
12	UniProt	VAR_002678	H	123	P	IL2RG_HUMAN	Disease (XSCID)	---	C/D	H	101	P
13	UniProt	VAR_002679	Y	125	N	IL2RG_HUMAN	Disease (XSCID)	---	C/D	Y	103	N
14	UniProt	VAR_002680	Q	144	P	IL2RG_HUMAN	Disease (XSCID)	---	C/D	Q	122	P
15	UniProt	VAR_002681	I	153	N	IL2RG_HUMAN	Disease (XSCID)	111033621	C/D	I	131	N
16	UniProt	VAR_002682	A	156	V	IL2RG_HUMAN	Disease (XSCID)	---	C/D	A	134	V
17	UniProt	VAR_002683	L	162	H	IL2RG_HUMAN	Disease (XSCID)	---	C/D	L	140	H
18	UniProt	VAR_002684	L	172	P	IL2RG_HUMAN	Disease (XSCID)	---	C/D	L	150	P
19	UniProt	VAR_002685	L	172	Q	IL2RG_HUMAN	Disease (XSCID)	---	C/D	L	150	Q
20	UniProt	VAR_002686	C	182	R	IL2RG_HUMAN	Disease (XSCID)	---	C/D	C	160	R
21	UniProt	VAR_002687	L	183	S	IL2RG_HUMAN	Disease (XSCID)	---	C/D	L	161	S
22	UniProt	VAR_002688	R	222	C	IL2RG_HUMAN	Disease (XCID)	111033618	C/D	R	200	C
23	UniProt	VAR_002689	R	224	W	IL2RG_HUMAN	Disease (XSCID)	869320658	C/D	R	202	W
24	UniProt	VAR_002690	R	226	C	IL2RG_HUMAN	Disease (XSCID)	869320659	C/D	R	204	C
25	UniProt	VAR_002691	R	226	H	IL2RG_HUMAN	Disease (XSCID)	869320660	C/D	R	204	H
26	UniProt	VAR_002692	F	227	C	IL2RG_HUMAN	Disease (XSCID)	---	C/D	F	205	C
27	UniProt	VAR_002693	L	230	P	IL2RG_HUMAN	Disease (XSCID)	---	C/D	L	208	P
28	UniProt	VAR_002694	C	231	Y	IL2RG_HUMAN	Disease (XSCID)	---	C/D	C	209	Y
29	UniProt	VAR_002695	G	232	R	IL2RG_HUMAN	Disease (XSCID)	---	C/D	G	210	R
30	UniProt	VAR_002697	W	240	C	IL2RG_HUMAN	Disease (XSCID)	---	C/D	W	218	C
31	UniProt	VAR_002698	S	241	I	IL2RG_HUMAN	Disease (XSCID)	---	C/D	S	219	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (31, 31)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_020392	C	27	R	IL4_HUMAN	Polymorphism	4986964	A	C	3	R
02	UniProt	VAR_002669	C	62	G	IL2RG_HUMAN	Disease (XSCID)	---	D	C	40	G
03	UniProt	VAR_002670	E	68	G	IL2RG_HUMAN	Disease (XSCID)	---	D	E	46	G
04	UniProt	VAR_002671	E	68	K	IL2RG_HUMAN	Disease (XSCID)	---	D	E	46	K
05	UniProt	VAR_002672	N	84	K	IL2RG_HUMAN	Disease (XSCID)	---	D	N	62	K
06	UniProt	VAR_002673	Y	89	C	IL2RG_HUMAN	Disease (XSCID)	---	D	Y	67	C
07	UniProt	VAR_002674	Y	105	C	IL2RG_HUMAN	Disease (XSCID)	193922347	D	Y	83	C
08	UniProt	VAR_020611	E	109	K	IL2RG_HUMAN	Polymorphism	17875899	D	E	87	K
09	UniProt	VAR_002675	G	114	D	IL2RG_HUMAN	Disease (XSCID)	111033620	D	G	92	D
10	UniProt	VAR_002676	C	115	F	IL2RG_HUMAN	Disease (XSCID)	---	D	C	93	F
11	UniProt	VAR_002677	C	115	R	IL2RG_HUMAN	Disease (XSCID)	111033622	D	C	93	R
12	UniProt	VAR_002678	H	123	P	IL2RG_HUMAN	Disease (XSCID)	---	D	H	101	P
13	UniProt	VAR_002679	Y	125	N	IL2RG_HUMAN	Disease (XSCID)	---	D	Y	103	N
14	UniProt	VAR_002680	Q	144	P	IL2RG_HUMAN	Disease (XSCID)	---	D	Q	122	P
15	UniProt	VAR_002681	I	153	N	IL2RG_HUMAN	Disease (XSCID)	111033621	D	I	131	N
16	UniProt	VAR_002682	A	156	V	IL2RG_HUMAN	Disease (XSCID)	---	D	A	134	V
17	UniProt	VAR_002683	L	162	H	IL2RG_HUMAN	Disease (XSCID)	---	D	L	140	H
18	UniProt	VAR_002684	L	172	P	IL2RG_HUMAN	Disease (XSCID)	---	D	L	150	P
19	UniProt	VAR_002685	L	172	Q	IL2RG_HUMAN	Disease (XSCID)	---	D	L	150	Q
20	UniProt	VAR_002686	C	182	R	IL2RG_HUMAN	Disease (XSCID)	---	D	C	160	R
21	UniProt	VAR_002687	L	183	S	IL2RG_HUMAN	Disease (XSCID)	---	D	L	161	S
22	UniProt	VAR_002688	R	222	C	IL2RG_HUMAN	Disease (XCID)	111033618	D	R	200	C
23	UniProt	VAR_002689	R	224	W	IL2RG_HUMAN	Disease (XSCID)	869320658	D	R	202	W
24	UniProt	VAR_002690	R	226	C	IL2RG_HUMAN	Disease (XSCID)	869320659	D	R	204	C
25	UniProt	VAR_002691	R	226	H	IL2RG_HUMAN	Disease (XSCID)	869320660	D	R	204	H
26	UniProt	VAR_002692	F	227	C	IL2RG_HUMAN	Disease (XSCID)	---	D	F	205	C
27	UniProt	VAR_002693	L	230	P	IL2RG_HUMAN	Disease (XSCID)	---	D	L	208	P
28	UniProt	VAR_002694	C	231	Y	IL2RG_HUMAN	Disease (XSCID)	---	D	C	209	Y
29	UniProt	VAR_002695	G	232	R	IL2RG_HUMAN	Disease (XSCID)	---	D	G	210	R
30	UniProt	VAR_002697	W	240	C	IL2RG_HUMAN	Disease (XSCID)	---	D	W	218	C
31	UniProt	VAR_002698	S	241	I	IL2RG_HUMAN	Disease (XSCID)	---	D	S	219	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (31, 31)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_020392	C	27	R	IL4_HUMAN	Polymorphism	4986964	B	C	3	R
02	UniProt	VAR_002669	C	62	G	IL2RG_HUMAN	Disease (XSCID)	---	C	C	40	G
03	UniProt	VAR_002670	E	68	G	IL2RG_HUMAN	Disease (XSCID)	---	C	E	46	G
04	UniProt	VAR_002671	E	68	K	IL2RG_HUMAN	Disease (XSCID)	---	C	E	46	K
05	UniProt	VAR_002672	N	84	K	IL2RG_HUMAN	Disease (XSCID)	---	C	N	62	K
06	UniProt	VAR_002673	Y	89	C	IL2RG_HUMAN	Disease (XSCID)	---	C	Y	67	C
07	UniProt	VAR_002674	Y	105	C	IL2RG_HUMAN	Disease (XSCID)	193922347	C	Y	83	C
08	UniProt	VAR_020611	E	109	K	IL2RG_HUMAN	Polymorphism	17875899	C	E	87	K
09	UniProt	VAR_002675	G	114	D	IL2RG_HUMAN	Disease (XSCID)	111033620	C	G	92	D
10	UniProt	VAR_002676	C	115	F	IL2RG_HUMAN	Disease (XSCID)	---	C	C	93	F
11	UniProt	VAR_002677	C	115	R	IL2RG_HUMAN	Disease (XSCID)	111033622	C	C	93	R
12	UniProt	VAR_002678	H	123	P	IL2RG_HUMAN	Disease (XSCID)	---	C	H	101	P
13	UniProt	VAR_002679	Y	125	N	IL2RG_HUMAN	Disease (XSCID)	---	C	Y	103	N
14	UniProt	VAR_002680	Q	144	P	IL2RG_HUMAN	Disease (XSCID)	---	C	Q	122	P
15	UniProt	VAR_002681	I	153	N	IL2RG_HUMAN	Disease (XSCID)	111033621	C	I	131	N
16	UniProt	VAR_002682	A	156	V	IL2RG_HUMAN	Disease (XSCID)	---	C	A	134	V
17	UniProt	VAR_002683	L	162	H	IL2RG_HUMAN	Disease (XSCID)	---	C	L	140	H
18	UniProt	VAR_002684	L	172	P	IL2RG_HUMAN	Disease (XSCID)	---	C	L	150	P
19	UniProt	VAR_002685	L	172	Q	IL2RG_HUMAN	Disease (XSCID)	---	C	L	150	Q
20	UniProt	VAR_002686	C	182	R	IL2RG_HUMAN	Disease (XSCID)	---	C	C	160	R
21	UniProt	VAR_002687	L	183	S	IL2RG_HUMAN	Disease (XSCID)	---	C	L	161	S
22	UniProt	VAR_002688	R	222	C	IL2RG_HUMAN	Disease (XCID)	111033618	C	R	200	C
23	UniProt	VAR_002689	R	224	W	IL2RG_HUMAN	Disease (XSCID)	869320658	C	R	202	W
24	UniProt	VAR_002690	R	226	C	IL2RG_HUMAN	Disease (XSCID)	869320659	C	R	204	C
25	UniProt	VAR_002691	R	226	H	IL2RG_HUMAN	Disease (XSCID)	869320660	C	R	204	H
26	UniProt	VAR_002692	F	227	C	IL2RG_HUMAN	Disease (XSCID)	---	C	F	205	C
27	UniProt	VAR_002693	L	230	P	IL2RG_HUMAN	Disease (XSCID)	---	C	L	208	P
28	UniProt	VAR_002694	C	231	Y	IL2RG_HUMAN	Disease (XSCID)	---	C	C	209	Y
29	UniProt	VAR_002695	G	232	R	IL2RG_HUMAN	Disease (XSCID)	---	C	G	210	R
30	UniProt	VAR_002697	W	240	C	IL2RG_HUMAN	Disease (XSCID)	---	C	W	218	C
31	UniProt	VAR_002698	S	241	I	IL2RG_HUMAN	Disease (XSCID)	---	C	S	219	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (3, 6)

Exons (8, 16)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:123
 aligned with D4HNR6_HUMAN | D4HNR6 from UniProtKB/TrEMBL  Length:153

    Alignment length:125
                                    36        46        56        66        76        86        96       106       116       126       136       146     
         D4HNR6_HUMAN    27 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC 151
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh..hhhh.ee..........hhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh........--.eehhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) R---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qb7 A   3 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKE--QSTLENFLERLRVIMQSKWFKC 127
                                    12        22        32        42        52        62        72        82        92       102|  |   112       122     
                                                                                                                              103  |                     
                                                                                                                                 106

Chain A from PDB  Type:PROTEIN  Length:123
 aligned with IL4_HUMAN | P05112 from UniProtKB/Swiss-Prot  Length:153

    Alignment length:125
                                    36        46        56        66        76        86        96       106       116       126       136       146     
            IL4_HUMAN    27 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC 151
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh..hhhh.ee..........hhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh........--.eehhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) R---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----INTERLEUKIN_4_13          ----------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1a          Exon 1.2b       Exon 1.3b  PDB: A:38-96 UniProt: 62-120                    Exon 1.4b  PDB: A:97-127 (gaps) Transcript 1
                 3qb7 A   3 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKE--QSTLENFLERLRVIMQSKWFKC 127
                                    12        22        32        42        52        62        72        82        92       102|  |   112       122     
                                                                                                                              103  |                     
                                                                                                                                 106

Chain B from PDB  Type:PROTEIN  Length:125
 aligned with D4HNR6_HUMAN | D4HNR6 from UniProtKB/TrEMBL  Length:153

    Alignment length:125
                                    36        46        56        66        76        86        96       106       116       126       136       146     
         D4HNR6_HUMAN    27 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC 151
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh........eee.........hhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeehhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) R---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qb7 B   3 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLRVIMQSKWFKC 127
                                    12        22        32        42        52        62        72        82        92       102       112       122

Chain B from PDB  Type:PROTEIN  Length:125
 aligned with IL4_HUMAN | P05112 from UniProtKB/Swiss-Prot  Length:153

    Alignment length:125
                                    36        46        56        66        76        86        96       106       116       126       136       146     
            IL4_HUMAN    27 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC 151
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh........eee.........hhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeehhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) R---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----INTERLEUKIN_4_13          ----------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1a          Exon 1.2b       Exon 1.3b  PDB: B:38-96 UniProt: 62-120                    Exon 1.4b  PDB: B:97-127        Transcript 1
                 3qb7 B   3 CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLRVIMQSKWFKC 127
                                    12        22        32        42        52        62        72        82        92       102       112       122

Chain C from PDB  Type:PROTEIN  Length:191
 aligned with IL2RG_HUMAN | P31785 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:194
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244    
          IL2RG_HUMAN    55 LPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGS 248
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee...eeeeee..---......eeeeee........ee...eeee..eeeeeeehhhhh.....eeeeee.......eeeeee.....ee....eeeeeee.....eeeeee...hhhhheeeeeee.......eeeee.....eee........eeeeeeee.................eee.. Sec.struct. author
             SAPs(SNPs) (1) -------G-----G---------------K----C---------------C---K----DF-------P-N------------------P--------N--V-----H---------P---------RS--------------------------------------C-W-CC--PYR-------CI------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------K----------------------------------------------R--------------------------------------------------------Q-----------------------------------------------------H---------------------- SAPs(SNPs) (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------FN3  PDB: C:134-226 UniProt: 156-253                                                          PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_S_F1  PDB: C:191-224 -- PROSITE (2)
           Transcript 2 (1) Exon 2.2j  PDB: C:33-68 (gaps)      -------------------------------------------------------------Exon 2.3e  PDB: C:130-176 UniProt: 152-198     Exon 2.4a  PDB: C:177-226 UniProt: 199-253         Transcript 2 (1)
           Transcript 2 (2) -----------------------------------Exon 2.3b  PDB: C:68-130 UniProt: 90-152                       ------------------------------------------------------------------------------------------------ Transcript 2 (2)
                 3qb7 C  33 LPLPEVQCFVFNVEYMNCTWQS---PQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGS 226
                                    42        52 |   |  62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222    
                                                54  58

Chain D from PDB  Type:PROTEIN  Length:183
 aligned with IL2RG_HUMAN | P31785 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:194
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244    
          IL2RG_HUMAN    55 LPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGS 248
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee...eeeeee.......--..eeeeee....---.ee...eee....eeeeeee.hhh.....eeeeee.......eeeeeehhhhh......eeeeee..---..eeeee.......eeeeeeee.......eeeee....eee.---.....eeeeeeeee................eee.. Sec.struct. author
             SAPs(SNPs) (1) -------G-----G---------------K----C---------------C---K----DF-------P-N------------------P--------N--V-----H---------P---------RS--------------------------------------C-W-CC--PYR-------CI------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------K----------------------------------------------R--------------------------------------------------------Q-----------------------------------------------------H---------------------- SAPs(SNPs) (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------FN3  PDB: D:134-226 UniProt: 156-253                                                          PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_S_F1  PDB: D:192-224 -- PROSITE (2)
           Transcript 2 (1) Exon 2.2j  PDB: D:33-68 (gaps)      -------------------------------------------------------------Exon 2.3e  PDB: D:130-176 (gaps)               Exon 2.4a  PDB: D:177-226 (gaps) UniProt: 199-253  Transcript 2 (1)
           Transcript 2 (2) -----------------------------------Exon 2.3b  PDB: D:68-130 (gaps) UniProt: 90-152                ------------------------------------------------------------------------------------------------ Transcript 2 (2)
                 3qb7 D  33 LPLPEVQCFVFNVEYMNCTWQSSSEPQ--NLTLHYWYKNSD---VQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKL---QLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSL---DGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGS 226
                                    42        52      | 62        72|   |   82        92       102       112       122       132       142|   |  152       162       172       182     | 192       202       212       222    
                                                     59 62         73  77                                                               143 147                                      188 192

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (97, 158)

Asymmetric Unit(hide GO term definitions)

Chain A,B (IL4_HUMAN | P05112)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005126	cytokine receptor binding	Interacting selectively and non-covalently with a cytokine receptor.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0005136	interleukin-4 receptor binding	Interacting selectively and non-covalently with the interleukin-4 receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0042113	B cell activation	The change in morphology and behavior of a mature or immature B cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0031296	B cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the B cell receptor to augment B cell activation.
	GO:0030183	B cell differentiation	The process in which a precursor cell type acquires the specialized features of a B cell. A B cell is a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
	GO:0002296	T-helper 1 cell lineage commitment	The process in which a CD4-positive, alpha-beta T cell becomes committed to becoming a T-helper 1 cell, a CD4-positive, alpha-beta T cell specialized to promote immunological processes often associated with resistance to intracellular bacteria, fungi, and protozoa, and pathological conditions such as arthritis.
	GO:0035745	T-helper 2 cell cytokine production	Any process that contributes to cytokine production by a T-helper 2 cell.
	GO:0045064	T-helper 2 cell differentiation	The process in which a relatively unspecialized T cell acquires specialized features of a T-helper 2 (Th2) cell. A Th2 cell is a CD4-positive, alpha-beta T cell that has the phenotype GATA-3-positive and produces interleukin-4.
	GO:0006968	cellular defense response	A defense response that is mediated by cells.
	GO:0071288	cellular response to mercury ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mercury ion stimulus.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0008203	cholesterol metabolic process	The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
	GO:0045189	connective tissue growth factor biosynthetic process	The chemical reactions and pathways resulting in the formation of CTGF, produced by human umbilical vein endothelial cells and by skin fibroblasts after activation with TGF-beta.
	GO:0042832	defense response to protozoan	Reactions triggered in response to the presence of a protozoan that act to protect the cell or organism.
	GO:0097028	dendritic cell differentiation	The process in which a precursor cell type acquires the specialized features of a dendritic cell. A dendritic cell is a leukocyte of dendritic lineage specialized in the uptake, processing, and transport of antigens to lymph nodes for the purpose of stimulating an immune response via T cell activation.
	GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
	GO:0007565	female pregnancy	The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002227	innate immune response in mucosa	Any process of the innate immune response that takes place in the mucosal tissues.
	GO:0001774	microglial cell activation	The change in morphology and behavior of a microglial cell resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0043011	myeloid dendritic cell differentiation	The process in which a monocyte acquires the specialized features of a dendritic cell, an immunocompetent cell of the lymphoid and hemopoietic systems and skin.
	GO:0050868	negative regulation of T cell activation	Any process that stops, prevents, or reduces the frequency, rate or extent of T cell activation.
	GO:2000320	negative regulation of T-helper 17 cell differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of T-helper 17 cell differentiation.
	GO:0002674	negative regulation of acute inflammatory response	Any process that stops, prevents, or reduces the frequency, rate, or extent of an acute inflammatory response.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0002677	negative regulation of chronic inflammatory response	Any process that stops, prevents, or reduces the frequency, rate, or extent of a chronic inflammatory response.
	GO:1903660	negative regulation of complement-dependent cytotoxicity	Any process that stops, prevents or reduces the frequency, rate or extent of complement-dependent cytotoxicity.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
	GO:0010633	negative regulation of epithelial cell migration	Any process that stops, prevents, or reduces the frequency, rate or extent of epithelial cell migration.
	GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
	GO:0043031	negative regulation of macrophage activation	Any process that stops, prevents, or reduces the frequency, rate or extent of macrophage activation.
	GO:0045019	negative regulation of nitric oxide biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
	GO:0045671	negative regulation of osteoclast differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of osteoclast differentiation.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0070351	negative regulation of white fat cell proliferation	Any process that stops or decreases the rate or extent of white fat cell proliferation.
	GO:0050871	positive regulation of B cell activation	Any process that activates or increases the frequency, rate or extent of B cell activation.
	GO:0030890	positive regulation of B cell proliferation	Any process that activates or increases the rate or extent of B cell proliferation.
	GO:0045348	positive regulation of MHC class II biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of MHC class II.
	GO:0045582	positive regulation of T cell differentiation	Any process that activates or increases the frequency, rate or extent of T cell differentiation.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0042104	positive regulation of activated T cell proliferation	Any process that activates or increases the rate or extent of activated T cell proliferation.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045080	positive regulation of chemokine biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of chemokines.
	GO:0002230	positive regulation of defense response to virus by host	Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
	GO:2000424	positive regulation of eosinophil chemotaxis	Any process that activates or increases the frequency, rate or extent of eosinophil chemotaxis.
	GO:0002639	positive regulation of immunoglobulin production	Any process that activates or increases the frequency, rate, or extent of immunoglobulin production.
	GO:0032733	positive regulation of interleukin-10 production	Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
	GO:0032736	positive regulation of interleukin-13 production	Any process that activates or increases the frequency, rate, or extent of interleukin-13 production.
	GO:0048295	positive regulation of isotype switching to IgE isotypes	Any process that activates or increases the frequency, rate or extent of isotype switching to IgE isotypes.
	GO:0048304	positive regulation of isotype switching to IgG isotypes	Any process that activates or increases the frequency, rate or extent of isotype switching to IgG isotypes.
	GO:0043306	positive regulation of mast cell degranulation	Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
	GO:0071677	positive regulation of mononuclear cell migration	Any process that increases the rate, frequency or extent of mononuclear cell migration. Mononuclear cell migration is the movement of a mononuclear cell within or between different tissues and organs of the body.
	GO:1901741	positive regulation of myoblast fusion	Any process that activates or increases the frequency, rate or extent of myoblast fusion.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0050727	regulation of inflammatory response	Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
	GO:0045191	regulation of isotype switching	Any process that modulates the frequency, rate or extent of isotype switching.
	GO:0042325	regulation of phosphorylation	Any process that modulates the frequency, rate or extent of addition of phosphate groups into a molecule.
	GO:0010155	regulation of proton transport	Any process that modulates the frequency, rate or extent of proton transport into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0007584	response to nutrient	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0060041	retina development in camera-type eye	The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
	GO:0042092	type 2 immune response	An immune response which is associated with resistance to extracellular organisms such as helminths and pathological conditions such as allergy, which is orchestrated by the production of particular cytokines, most notably IL-4, IL-5, IL-10, and IL-13, by any of a variety of cell types including T-helper 2 cells, eosinophils, basophils, mast cells, and nuocytes, resulting in enhanced production of certain antibody isotypes and other effects.
cellular component
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain A,B (D4HNR6_HUMAN | D4HNR6)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005126	cytokine receptor binding	Interacting selectively and non-covalently with a cytokine receptor.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0005136	interleukin-4 receptor binding	Interacting selectively and non-covalently with the interleukin-4 receptor.
biological process
	GO:0042113	B cell activation	The change in morphology and behavior of a mature or immature B cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0031296	B cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the B cell receptor to augment B cell activation.
	GO:0002296	T-helper 1 cell lineage commitment	The process in which a CD4-positive, alpha-beta T cell becomes committed to becoming a T-helper 1 cell, a CD4-positive, alpha-beta T cell specialized to promote immunological processes often associated with resistance to intracellular bacteria, fungi, and protozoa, and pathological conditions such as arthritis.
	GO:0045064	T-helper 2 cell differentiation	The process in which a relatively unspecialized T cell acquires specialized features of a T-helper 2 (Th2) cell. A Th2 cell is a CD4-positive, alpha-beta T cell that has the phenotype GATA-3-positive and produces interleukin-4.
	GO:0071288	cellular response to mercury ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mercury ion stimulus.
	GO:0008203	cholesterol metabolic process	The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
	GO:0042832	defense response to protozoan	Reactions triggered in response to the presence of a protozoan that act to protect the cell or organism.
	GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
	GO:0007565	female pregnancy	The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002227	innate immune response in mucosa	Any process of the innate immune response that takes place in the mucosal tissues.
	GO:0001774	microglial cell activation	The change in morphology and behavior of a microglial cell resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0050868	negative regulation of T cell activation	Any process that stops, prevents, or reduces the frequency, rate or extent of T cell activation.
	GO:2000320	negative regulation of T-helper 17 cell differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of T-helper 17 cell differentiation.
	GO:0002674	negative regulation of acute inflammatory response	Any process that stops, prevents, or reduces the frequency, rate, or extent of an acute inflammatory response.
	GO:0002677	negative regulation of chronic inflammatory response	Any process that stops, prevents, or reduces the frequency, rate, or extent of a chronic inflammatory response.
	GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
	GO:0043031	negative regulation of macrophage activation	Any process that stops, prevents, or reduces the frequency, rate or extent of macrophage activation.
	GO:0045019	negative regulation of nitric oxide biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
	GO:0045671	negative regulation of osteoclast differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of osteoclast differentiation.
	GO:0070351	negative regulation of white fat cell proliferation	Any process that stops or decreases the rate or extent of white fat cell proliferation.
	GO:0050871	positive regulation of B cell activation	Any process that activates or increases the frequency, rate or extent of B cell activation.
	GO:0030890	positive regulation of B cell proliferation	Any process that activates or increases the rate or extent of B cell proliferation.
	GO:0045348	positive regulation of MHC class II biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of MHC class II.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0042104	positive regulation of activated T cell proliferation	Any process that activates or increases the rate or extent of activated T cell proliferation.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045080	positive regulation of chemokine biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of chemokines.
	GO:0002230	positive regulation of defense response to virus by host	Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
	GO:2000424	positive regulation of eosinophil chemotaxis	Any process that activates or increases the frequency, rate or extent of eosinophil chemotaxis.
	GO:0002639	positive regulation of immunoglobulin production	Any process that activates or increases the frequency, rate, or extent of immunoglobulin production.
	GO:0032733	positive regulation of interleukin-10 production	Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
	GO:0048295	positive regulation of isotype switching to IgE isotypes	Any process that activates or increases the frequency, rate or extent of isotype switching to IgE isotypes.
	GO:0048304	positive regulation of isotype switching to IgG isotypes	Any process that activates or increases the frequency, rate or extent of isotype switching to IgG isotypes.
	GO:0043306	positive regulation of mast cell degranulation	Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
	GO:0071677	positive regulation of mononuclear cell migration	Any process that increases the rate, frequency or extent of mononuclear cell migration. Mononuclear cell migration is the movement of a mononuclear cell within or between different tissues and organs of the body.
	GO:1901741	positive regulation of myoblast fusion	Any process that activates or increases the frequency, rate or extent of myoblast fusion.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0050727	regulation of inflammatory response	Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
	GO:0010155	regulation of proton transport	Any process that modulates the frequency, rate or extent of proton transport into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0007584	response to nutrient	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0060041	retina development in camera-type eye	The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
cellular component
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain C,D (IL2RG_HUMAN | P31785)

molecular function
	GO:0005088	Ras guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0019976	interleukin-2 binding	Interacting selectively and non-covalently with interleukin-2.
	GO:0004911	interleukin-2 receptor activity	Combining with interleukin-2 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0004913	interleukin-4 receptor activity	Combining with interleukin-4 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0019982	interleukin-7 binding	Interacting selectively and non-covalently with interleukin-7.
	GO:0004917	interleukin-7 receptor activity	Combining with interleukin-7 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0038110	interleukin-2-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-2 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0035771	interleukin-4-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-4 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0038111	interleukin-7-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-7 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (12, 12)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (31, 62)

PROSITE Motifs (3, 6)

Exons (8, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (97, 158)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File