|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric/Biological Unit (3, 5) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3PO0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3PO0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3PO0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3PO0) |
Exons (0, 0)| (no "Exon" information available for 3PO0) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:89 aligned with SAMP1_HALVD | D4GUF6 from UniProtKB/Swiss-Prot Length:87 Alignment length:89 1 | 8 18 28 38 48 58 68 78 SAMP1_HALVD - --MEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG 87 SCOP domains ----------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----ThiS-3po0A01 A:3-87 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 3po0 A -1 GSMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG 87 8 18 28 38 48 58 68 78
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3PO0) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3PO0) |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (SAMP1_HALVD | D4GUF6)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|