3NYB - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:323
 aligned with PAP2_YEAST | P53632 from UniProtKB/Swiss-Prot  Length:584

    Alignment length:323
                                   168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478   
           PAP2_YEAST   159 TDYPWILNHDHSKQKEISDWLTFEIKDFVAYISPSREEIEIRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVVTSELGGKESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFERTNGIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSDGYPVYFPKSTWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFAGAFDLLTNRCFELHSATFKDRLGKSILGNVIKY 481
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------NTP_transf_2-3nybA01 A:204-318                                                                                     ----------------------------------------------------PAP_assoc-3nybA02 A:371-431                                  -------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh........hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh......eeee.............eeeee....hhhhhhhhhhhhhhhhhhh......eeee....eeeeeee....eeeeee......hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhh..hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.....eeeee....eeeee.hhhhhhh..........ee..eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3nyb A 159 GSYPWILNHDHSKQKEISDWLTFEIKDFVAYISPSREEIEIRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVVTSELGGKESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIAVSFERTNGIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSDGYPVYFPKSTWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFAGAFDLLTNRCFELHSATFKDRLGKSILGNVIKY 481
                                   168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478

Chain B from PDB  Type:PROTEIN  Length:64
 aligned with AIR2_YEAST | Q12476 from UniProtKB/Swiss-Prot  Length:344

    Alignment length:77
                                   131       141       151       161       171       181       191       
           AIR2_YEAST   122 QCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNL 198
               SCOP domains ----------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------zf-CCHC-3nybB01   ------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhh......-------------.............hhhhh..................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------ZF_CCHC         ------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                 3nyb B 122 QCTLCKSKKHSKERCPSIWRAYILV-------------HTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNL 198
                                   131       141    |    -       161       171       181       191       
                                                  146           160

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PAP2_YEAST | P53632)

molecular function
	GO:0051575	5'-deoxyribose-5-phosphate lyase activity	Catalysis of the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site in DNA where a DNA-(apurinic or apyrimidinic site) lyase has already cleaved the C-O-P bond 3' to the apurinic or apyrimidinic site.
	GO:0034459	ATP-dependent 3'-5' RNA helicase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction drives the unwinding of an RNA helix in the direction 3' to 5'.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0004652	polynucleotide adenylyltransferase activity	Catalysis of the template-independent extension of the 3'- end of an RNA or DNA strand by addition of one adenosine molecule at a time. Cannot initiate a chain 'de novo'. The primer, depending on the source of the enzyme, may be an RNA or DNA fragment, or oligo(A) bearing a 3'-OH terminal group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0034475	U4 snRNA 3'-end processing	Any process involved in forming the mature 3' end of a U4 snRNA molecule.
	GO:0006284	base-excision repair	In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0071044	histone mRNA catabolic process	The chemical reactions and pathways resulting in the breakdown of histone messenger RNA (mRNA).
	GO:0042138	meiotic DNA double-strand break formation	The cell cycle process in which double-strand breaks are generated at defined hotspots throughout the genome during meiosis I. This results in the initiation of meiotic recombination.
	GO:0043629	ncRNA polyadenylation	The enzymatic addition of a sequence of adenylyl residues at the 3' end of a non-coding RNA (ncRNA) molecule. In eukaryotes, substrates include nuclear non-coding RNAs such as precursors and a variety of incorrectly processed forms of snRNAs, snoRNAs, rRNAs, and tRNAs, as well as discarded RNA fragments which have been removed from ncRNA primary transcripts. Polyadenylation of precursors is often linked to termination of transcription, but polyadenylation of RNAs targeted for degradation may also occur post-transcriptionally. This polyadenylation is important both for 3'-end processing to produce mature ncRNA species and also for targeting incorrectly processed or discarded RNA molecules for degradation.
	GO:0045910	negative regulation of DNA recombination	Any process that stops, prevents, or reduces the frequency, rate or extent of DNA recombination.
	GO:0071031	nuclear mRNA surveillance of mRNA 3'-end processing	The set of processes involved in identifying and degrading mRNAs with incorrectly formed 3'-ends within the nucleus.
	GO:0071039	nuclear polyadenylation-dependent CUT catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a cryptic unstable transcript (CUT), initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target CUT.
	GO:0071040	nuclear polyadenylation-dependent antisense transcript catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of an antisense transcript, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target antisense transcript.
	GO:0071042	nuclear polyadenylation-dependent mRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a messenger RNA (mRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target mRNA.
	GO:0071035	nuclear polyadenylation-dependent rRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a ribosomal RNA (rRNA) molecule, including RNA fragments released as part of processing the primary transcript into multiple mature rRNA species, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target rRNA.
	GO:0071037	nuclear polyadenylation-dependent snRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a small nuclear RNA (snRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target snRNA.
	GO:0071036	nuclear polyadenylation-dependent snoRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a small nucleolar RNA (snoRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target snoRNA.
	GO:0071038	nuclear polyadenylation-dependent tRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of an aberrant or incorrectly modified transfer RNA (tRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target tRNA.
	GO:0071047	polyadenylation-dependent mRNA catabolic process	The chemical reactions and pathways resulting in the breakdown of a messenger RNA (mRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target mRNA.
	GO:0071051	polyadenylation-dependent snoRNA 3'-end processing	Any process involved in forming the mature 3' end of a snoRNA molecule linked to prior polyadenylation of the 3'-end of the precursor snoRNA.
	GO:0071050	snoRNA polyadenylation	The enzymatic addition of a sequence of adenylyl residues at the 3' end of snoRNA molecule. In eukaryotes, this occurs in conjunction with termination of transcription of precursor snoRNA molecules and may occur post-transcriptionally on incorrectly processed molecules targeted for degradation.
	GO:0006400	tRNA modification	The covalent alteration of one or more nucleotides within a tRNA molecule to produce a tRNA molecule with a sequence that differs from that coded genetically.
cellular component
	GO:0031499	TRAMP complex	A multiprotein complex having distributive polyadenylation activity of a variety of RNA substrates including hypomodified and incorrectly folded tRNAs, pre-snRNAs, pre-snoRNAs, incorrectly spliced or processed pre-mRNAs, cryptic unstable transcripts (CUTs), pre-rRNAs and rRNA fragments released as part of rRNA processing. In S. cerevisiae, the complex consists of either Pap2 (also known as Trf4) or Trf5, Air1 or Air2, and Mtr4, and is involved in RNA 3'-end processing and in RNA surveillance and quality control.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (AIR2_YEAST | Q12476)

molecular function
	GO:0034459	ATP-dependent 3'-5' RNA helicase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction drives the unwinding of an RNA helix in the direction 3' to 5'.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0004652	polynucleotide adenylyltransferase activity	Catalysis of the template-independent extension of the 3'- end of an RNA or DNA strand by addition of one adenosine molecule at a time. Cannot initiate a chain 'de novo'. The primer, depending on the source of the enzyme, may be an RNA or DNA fragment, or oligo(A) bearing a 3'-OH terminal group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030674	protein binding, bridging	The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0043629	ncRNA polyadenylation	The enzymatic addition of a sequence of adenylyl residues at the 3' end of a non-coding RNA (ncRNA) molecule. In eukaryotes, substrates include nuclear non-coding RNAs such as precursors and a variety of incorrectly processed forms of snRNAs, snoRNAs, rRNAs, and tRNAs, as well as discarded RNA fragments which have been removed from ncRNA primary transcripts. Polyadenylation of precursors is often linked to termination of transcription, but polyadenylation of RNAs targeted for degradation may also occur post-transcriptionally. This polyadenylation is important both for 3'-end processing to produce mature ncRNA species and also for targeting incorrectly processed or discarded RNA molecules for degradation.
	GO:0071031	nuclear mRNA surveillance of mRNA 3'-end processing	The set of processes involved in identifying and degrading mRNAs with incorrectly formed 3'-ends within the nucleus.
	GO:0071039	nuclear polyadenylation-dependent CUT catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a cryptic unstable transcript (CUT), initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target CUT.
	GO:0071035	nuclear polyadenylation-dependent rRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a ribosomal RNA (rRNA) molecule, including RNA fragments released as part of processing the primary transcript into multiple mature rRNA species, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target rRNA.
	GO:0071037	nuclear polyadenylation-dependent snRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a small nuclear RNA (snRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target snRNA.
	GO:0071036	nuclear polyadenylation-dependent snoRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of a small nucleolar RNA (snoRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target snoRNA.
	GO:0071038	nuclear polyadenylation-dependent tRNA catabolic process	The chemical reactions and pathways occurring in the nucleus and resulting in the breakdown of an aberrant or incorrectly modified transfer RNA (tRNA) molecule, initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3' end the target tRNA.
	GO:0043633	polyadenylation-dependent RNA catabolic process	The chemical reactions and pathways resulting in the breakdown of an RNA molecule, initiated by initiated by the enzymatic addition of a sequence of adenylyl residues (polyadenylation) at the 3'-end of the target RNA.
	GO:0006400	tRNA modification	The covalent alteration of one or more nucleotides within a tRNA molecule to produce a tRNA molecule with a sequence that differs from that coded genetically.
cellular component
	GO:0031499	TRAMP complex	A multiprotein complex having distributive polyadenylation activity of a variety of RNA substrates including hypomodified and incorrectly folded tRNAs, pre-snRNAs, pre-snoRNAs, incorrectly spliced or processed pre-mRNAs, cryptic unstable transcripts (CUTs), pre-rRNAs and rRNA fragments released as part of rRNA processing. In S. cerevisiae, the complex consists of either Pap2 (also known as Trf4) or Trf5, Air1 or Air2, and Mtr4, and is involved in RNA 3'-end processing and in RNA surveillance and quality control.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (3, 3)

Gene Ontology (36, 51)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File