Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PROLACTIN RECEPTOR (PRLR) COMPLEXED WITH THE NATURAL HORMONE (PRL)
 
Authors :  J. Van Agthoven, P. England, V. Goffin, I. Broutin
Date :  29 Jun 10  (Deposition) - 06 Oct 10  (Release) - 30 Mar 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.35
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Protein Protein Complex, Hormone-Receptor Complex, Hormone, Hormone- Hormone Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Van Agthoven, C. Zhang, E. Tallet, B. Raynal, S. Hoos, B. Baron, P. England, V. Goffin, I. Broutin
Structural Characterization Of The Stem-Stem Dimerization Interface Between Prolactin Receptor Chains Complexed With The Natural Hormone.
J. Mol. Biol. V. 404 112 2010
PubMed-ID: 20875426  |  Reference-DOI: 10.1016/J.JMB.2010.09.036

(-) Compounds

Molecule 1 - PROLACTIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PT7L
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: HCG_36753, PRL, RP3-404K8.1-001
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PRL
 
Molecule 2 - PROLACTIN RECEPTOR
    Chains: B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PQE70
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: PRLR (UNP RESIDUES 20-229)
    Gene: PRLR
    Organism Common: BROWN RAT,RAT,RATS
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Synonym: PRL-R, LACTOGEN RECEPTOR

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3NPZ)

(-) Sites  (0, 0)

(no "Site" information available for 3NPZ)

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:4 -A:11
2A:58 -A:174
3A:191 -A:199
4B:12 -B:22
5B:51 -B:62
6C:12 -C:22
7C:51 -C:62

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Trp C:139 -Phe C:140

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3NPZ)

(-) PROSITE Motifs  (4, 8)

Asymmetric/Biological Unit (4, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FN3PS50853 Fibronectin type-III domain profile.PRLR_RAT22-122
 
124-224
 		  4B:3-103
C:3-103
B:105-204
C:105-204
2SOMATOTROPIN_1PS00266 Somatotropin, prolactin and related hormones signature 1.PRL_HUMAN86-119  1A:58-91
3HEMATOPO_REC_L_F1PS01352 Long hematopoietin receptor, single chain family signature.PRLR_RAT142-219
 		  2B:123-200
C:123-200
4SOMATOTROPIN_2PS00338 Somatotropin, prolactin and related hormones signature 2.PRL_HUMAN202-219  1A:174-191

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003064821ENSE00001148399chr6:22297730-22297184547PRL_HUMAN1-10100--
1.2cENST000003064822cENSE00001174381chr6:22294813-22294638176PRL_HUMAN10-68591A:2-40 (gaps)39
1.3ENST000003064823ENSE00001174368chr6:22292874-22292767108PRL_HUMAN69-104361A:41-7636
1.4ENST000003064824ENSE00001174359chr6:22290582-22290403180PRL_HUMAN105-164601A:77-13660
1.5ENST000003064825ENSE00001148390chr6:22287822-22287480343PRL_HUMAN165-227631A:137-199 (gaps)63

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:186
 aligned with PRL_HUMAN | P01236 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:198
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219        
            PRL_HUMAN    30 PICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC 227
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains Hor      mone_1-3npzA01 A:2-199                                                                                                                                                                        Pfam domains
         Sec.struct. author ...------...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh.....----..........--....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------SOMATOTROPIN_1  PDB: A:58-91      ------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------SOMATOTROPIN_2    -------- PROSITE (3)
               Transcript 1 Exon 1.2c  PDB: A:2-40 (gaps)          Exon 1.3  PDB: A:41-76              Exon 1.4  PDB: A:77-136 UniProt: 105-164                    Exon 1.5  PDB: A:137-199 (gaps) UniProt: 165-227                Transcript 1
                 3npz A   2 PIC------CQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK----YPVWSGLPSL--ADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC 199
                              |     11        21        31        41        51        61        71        81        91       101       111       121       131       141|    | 151    |  161       171       181       191        
                              4     11                                                                                                                                142  147      156  |                                        
                                                                                                                                                                                       159                                        


Chain B from PDB  Type:PROTEIN  Length:202
 aligned with PRLR_RAT | P05710 from UniProtKB/Swiss-Prot  Length:610

    Alignment length:204
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219    
             PRLR_RAT    20 QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN 223
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeee......eeeeee.........eeeeeee......eee..........eeee.........eeeeeeeee....eee...eeee.hhh......eeeeeeeee..--.eeeeeeee.............eeeeeeeee......eeeeee...eeee.......eeeeeeeeee...........eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --FN3  PDB: B:3-103 UniProt: 22-122                                                                    -FN3  PDB: B:105-204 UniProt: 124-224                                                                 PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F1  PDB: B:123-200 UniProt: 142-219                            ---- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3npz B   1 QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLK--KTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN 204
                                    10        20        30        40        50        60        70        80        90       100       110      |120       130       140       150       160       170       180       190       200    
                                                                                                                                              117  |                                                                                    
                                                                                                                                                 120                                                                                    


Chain C from PDB  Type:PROTEIN  Length:199
 aligned with PRLR_RAT | P05710 from UniProtKB/Swiss-Prot  Length:610

    Alignment length:204
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219    
             PRLR_RAT    20 QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN 223
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) EpoR_lig-bind-3npzC01 C:1-96                                                                    -------fn3-3npzC03    C:104-195                                                                    --------- Pfam domains (1)
           Pfam domains (2) EpoR_lig-bind-3npzC02 C:1-96                                                                    -------fn3-3npzC04    C:104-195                                                                    --------- Pfam domains (2)
         Sec.struct. author ........eeeee......eeeee..........eeeeee........ee..........eeee..........eeeeeeeee..ee.....eeehhhhh......eeeeeeee.---...eeeeeee..............eeeeeee..--...eeeee....eeee.......eeeeeeeee............eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --FN3  PDB: C:3-103 UniProt: 22-122                                                                    -FN3  PDB: C:105-204 UniProt: 124-224                                                                 PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F1  PDB: C:123-200 UniProt: 142-219                            ---- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3npz C   1 QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQ---KKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPE--EEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN 204
                                    10        20        30        40        50        60        70        80        90       100       110    |  120       130       140       150|  |   160       170       180       190       200    
                                                                                                                                            115 119                             151  |                                                  
                                                                                                                                                                                   154
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3NPZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NPZ)

(-) Pfam Domains  (3, 5)

Asymmetric/Biological Unit
(-)
Clan: 4H_Cytokine (48)
(-)
Clan: E-set (290)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PRL_HUMAN | P01236)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0005148    prolactin receptor binding    Interacting selectively and non-covalently with the prolactin receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0060397    JAK-STAT cascade involved in growth hormone signaling pathway    The process in which STAT proteins (Signal Transducers and Activators of Transcription) are activated by members of the JAK (janus activated kinase) family of tyrosine kinases, following the binding of physiological ligands to the growth hormone receptor. Once activated, STATs dimerize and translocate to the nucleus and modulate the expression of target genes.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0007565    female pregnancy    The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
    GO:0007595    lactation    The regulated release of milk from the mammary glands and the period of time that a mother lactates to feed her young.
    GO:0046427    positive regulation of JAK-STAT cascade    Any process that activates or increases the frequency, rate or extent of the JAK-STAT signaling pathway activity.
    GO:0040014    regulation of multicellular organism growth    Any process that modulates the frequency, rate or extent of growth of the body of an organism so that it reaches its usual body size.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Chain B,C   (PRLR_RAT | P05710)
molecular function
    GO:0004896    cytokine receptor activity    Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004925    prolactin receptor activity    Combining with prolactin and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0038161    prolactin signaling pathway    A series of molecular signals initiated by the binding of the peptide hormone prolactin to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3npz)
 
  Sites
(no "Sites" information available for 3npz)
 
  Cis Peptide Bonds
    Trp C:139 - Phe C:140   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3npz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PRLR_RAT | P05710
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PRL_HUMAN | P01236
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PRLR_RAT | P05710
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRL_HUMAN | P01236
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PRLR_RAT | P05710: 1f6f 3ew3
        PRL_HUMAN | P01236: 1rw5 2q98 3d48 3ew3 3mzg 3n06 3n0p 3ncb 3ncc 3nce 3ncf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3NPZ)