Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE TERNARY COMPLEX BETWEEN OVINE PLACENTAL LACTOGEN AND THE EXTRACELLULAR DOMAIN OF THE RAT PROLACTIN RECEPTOR
 
Authors :  P. A. Elkins, H. W. Christinger, Y. Sandowski, E. Sakal, A. Gertler, A. M. De Vos, A. A. Kossiakoff
Date :  21 Jun 00  (Deposition) - 04 Jul 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  4-Helical Bundle, Alpha Helical Bundle, Ternary Complex, Fn Iii Domains, Beta Sheet Domains, Cytokine-Receptor Complex, Hormone/Growth Factor/Hormone Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. A. Elkins, H. W. Christinger, Y. Sandowski, E. Sakal, A. Gertler, A. M. De Vos, A. A. Kossiakoff
Ternary Complex Between Placental Lactogen And The Extracellular Domain Of The Prolactin Receptor.
Nat. Struct. Biol. V. 7 808 2000
PubMed-ID: 10966654  |  Reference-DOI: 10.1038/79047
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PLACENTAL LACTOGEN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET8
    Expression System Taxid: 562
    Organism Common: SHEEP
    Organism Scientific: OVIS ARIES
    Organism Taxid: 9940
 
Molecule 2 - PROLACTIN RECEPTOR
    Chains: B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTRC99A
    Expression System Taxid: 562
    Fragment: EXTRACELLULAR DOMAIN
    Organ: LIVER
    Organism Common: NORWAY RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1F6F)

(-) Sites  (0, 0)

(no "Site" information available for 1F6F)

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:7 -A:14
2A:60 -A:175
3A:192 -A:197
4B:12 -B:22
5B:51 -B:62
6C:12 -C:22
7C:51 -C:62

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1F6F)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1F6F)

(-) PROSITE Motifs  (4, 6)

Asymmetric/Biological Unit (4, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FN3PS50853 Fibronectin type-III domain profile.PRLR_RAT22-122
124-224
 		  2-
B:105-203
C:105-204
2SOMATOTROPIN_1PS00266 Somatotropin, prolactin and related hormones signature 1.CSH_SHEEP97-130  1A:60-93
3HEMATOPO_REC_L_F1PS01352 Long hematopoietin receptor, single chain family signature.PRLR_RAT142-219
 		  2B:123-200
C:123-200
4SOMATOTROPIN_2PS00338 Somatotropin, prolactin and related hormones signature 2.CSH_SHEEP212-229  1A:175-192

(-) Exons   (0, 0)

(no "Exon" information available for 1F6F)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:183
 aligned with CSH_SHEEP | P16038 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:197
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       
            CSH_SHEEP    38 AQHPPYCRNQPGKCQIPLQSLFDRATTVANYNSKLAGEMVNRFDEQYGQGINSESKVINCHTSSITTPNSKAEAINTEDKILFKLVISLLHSWDEPLHHAVTELANSKGTSPALLTKAQEIKEKAKVLVDGVEVIQKRIHPGEKNEPYPVWSEQSSLTSQDENVRRVAFYRLFHCLHRDSSKIYTYLRILKCRLTSC 234
               SCOP domains d1f6fa_ A: Prolactin (placental lactogen)                                                                                                                                                             SCOP domains
               CATH domains 1f6fA00 A:1-197  [code=1.20.1250.10, no name de         fined]                                                                                                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..---------...hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh-----hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------SOMATOTROPIN_1  PDB: A:60-93      -------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SOMATOTROPIN_2    ----- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1f6f A   1 AQHPPYCRNQPGKCQIPLQSLFDRATTVANYNSKLAGEMVNRFDEQY---------VINCHTSSITTPNSKAEAINTEDKILFKLVISLLHSWDEPLHHAVTELAN-----PALLTKAQEIKEKAKVLVDGVEVIQKRIHPGEKNEPYPVWSEQSSLTSQDENVRRVAFYRLFHCLHRDSSKIYTYLRILKCRLTSC 197
                                    10        20        30        40      |  -      | 60        70        80        90       100     |   - |     120       130       140       150       160       170       180       190       
                                                                         47        57                                              106   112                                                                                     


Chain B from PDB  Type:PROTEIN  Length:195
 aligned with PRLR_RAT | P05710 from UniProtKB/Swiss-Prot  Length:610

    Alignment length:199
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213         
             PRLR_RAT    24 GKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMP 222
               SCOP domains d1f6fb1 B:5-100 Prolactin receptor                                                              d1f6fb2 B:101-    203 Prolactin receptor                                                                SCOP domains
               CATH domains 1f6fB01 B:5-101 Immunoglobulins                                                                  1f6fB02 B:102    -202 Immunoglobulins                                                                - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee......eeeeee.........eeeeeeee..eeeeee..........eeee.........eeeeeeeeee..eeee...eeee.hhh......eeeeeee.----....eeeeee.............eeeeeeeee......eeeeee...eeee.......eeeeeeeeee...........eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) FN3  PDB: - UniProt: 22-122                                                                        -FN3  PDB: B:105-203 UniProt: 124-224                                                                PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F1  PDB: B:123-200 UniProt: 142-219                            --- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1f6f B   5 GKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVK----KKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMP 203
                                    14        24        34        44        54        64        74        84        94       104       114    |  124       134       144       154       164       174       184       194         
                                                                                                                                       114  119                                                                                    


Chain C from PDB  Type:PROTEIN  Length:169
 aligned with PRLR_RAT | P05710 from UniProtKB/Swiss-Prot  Length:610

    Alignment length:199
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214         
             PRLR_RAT    25 KPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN 223
               SCOP domains d1f6fc1 C:6-100 Prolact     in receptor                                                        d1f6fc2 C:101-     204 Prolact          in recept     or                                                 SCOP domains
               CATH domains 1f6fC01 C:6-101 Immunog     lobulins                                                            1f6fC02 C:102     -199 Immuno          globulins                                                  ----- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee......eeeeee...-----.eeeeeeee......ee..........eeeehhhhh.....eeeeeeee-----.....eeehhhhh......eeeeeeee-----..eeeeeee..----------..eeeeee.-----..eeeeee...eeee.......eeeeeeeee............eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) FN3  PDB: - UniProt: 22-122                                                                       -FN3  PDB: C:105-204 UniProt: 124-224                                                                 PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F1  PDB: C:123-200 UniProt: 142-219                            ---- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1f6f C   6 KPEIHKCRSPDKETFTCWWNPGT-----TNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNAT-----SSSDPLYVDVTYIVEPEPPRNLTLEVK-----KTYLWVKWSPP----------TMEYEIRLK-----EWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN 204
                                    15        25  |     35        45        55        65        75      |  -  |     95       105        |-    |  125    |    -     | 145   |   155       165       175       185       195         
                                                 28    34                                              82    88                       114   120       130        141     149   155
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 5)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (2, 5)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1F6F)

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CSH_SHEEP | P16038)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0005148    prolactin receptor binding    Interacting selectively and non-covalently with the prolactin receptor.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B,C   (PRLR_RAT | P05710)
molecular function
    GO:0004896    cytokine receptor activity    Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004925    prolactin receptor activity    Combining with prolactin and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0038161    prolactin signaling pathway    A series of molecular signals initiated by the binding of the peptide hormone prolactin to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1f6f)
 
  Sites
(no "Sites" information available for 1f6f)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1f6f)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1f6f
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CSH_SHEEP | P16038
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PRLR_RAT | P05710
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CSH_SHEEP | P16038
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRLR_RAT | P05710
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PRLR_RAT | P05710: 3ew3 3npz

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1F6F)