Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN CYP11A1 IN COMPLEX WITH 20,22-DIHYDROXYCHOLESTEROL
 
Authors :  N. V. Strushkevich, F. Mackenzie, W. Tempel, A. Botchkarev, C. H. Arrow A. M. Edwards, C. Bountra, J. U. Weigelt, H. Park, Structural Genomic Consortium (Sgc)
Date :  31 May 10  (Deposition) - 08 Sep 10  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Cytochrome P450, 20, 22-Dihydroxycholesterol, Side Chain Cleavage, Structural Genomics, Structural Genomics Consortium, Sgc, Oxidoreductase, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Strushkevich, F. Mackenzie, T. Cherkesova, I. Grabovec, S. Usanov H. W. Park
Structural Basis For Pregnenolone Biosynthesis By The Mitochondrial Monooxygenase System.
Proc. Natl. Acad. Sci. Usa V. 108 10139 2011
PubMed-ID: 21636783  |  Reference-DOI: 10.1073/PNAS.1019441108

(-) Compounds

Molecule 1 - CHOLESTEROL SIDE-CHAIN CLEAVAGE ENZYME, MITOCHONDRIAL
    ChainsA, B
    EC Number1.14.15.6
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPCW
    Expression System StrainJM109
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 44-514
    GeneCYP11A, CYP11A1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCYTOCHROME P450 11A1, CYPXIA1, CYTOCHROME P450(SCC), CHOLESTEROL DESMOLASE
 
Molecule 2 - ADRENODOXIN, MITOCHONDRIAL
    ChainsC, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPCW
    Expression System StrainJM109
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 88-155
    GeneADRENODOXIN, ADX, FDX1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymADRENAL FERREDOXIN, FERREDOXIN-1, HEPATOREDOXIN

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A C 
Biological Unit 2 (1x) B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric Unit (3, 6)
No.NameCountTypeFull Name
12DC2Ligand/Ion(3ALPHA,8ALPHA,22R)-CHOLEST-5-ENE-3,20,22-TRIOL
2FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
3HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (3, 3)
No.NameCountTypeFull Name
12DC1Ligand/Ion(3ALPHA,8ALPHA,22R)-CHOLEST-5-ENE-3,20,22-TRIOL
2FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
3HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (3, 3)
No.NameCountTypeFull Name
12DC1Ligand/Ion(3ALPHA,8ALPHA,22R)-CHOLEST-5-ENE-3,20,22-TRIOL
2FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
3HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:24 , ARG A:120 , TRP A:147 , ARG A:151 , MET A:323 , GLY A:326 , GLY A:327 , THR A:330 , THR A:334 , LEU A:385 , ILE A:390 , SER A:391 , LEU A:394 , ARG A:396 , GLY A:454 , PHE A:455 , GLY A:456 , TRP A:457 , ARG A:460 , GLN A:461 , CYS A:462 , GLY A:464 , 2DC A:602BINDING SITE FOR RESIDUE HEM A 601
2AC2SOFTWAREHOH A:42 , LEU A:140 , MET A:240 , GLY A:326 , SER A:391 , GLN A:395 , LEU A:499 , ILE A:500 , HOH A:599 , HEM A:601BINDING SITE FOR RESIDUE 2DC A 602
3AC3SOFTWAREHOH B:27 , ARG B:120 , VAL B:139 , TRP B:147 , ARG B:151 , MET B:323 , GLY B:326 , GLY B:327 , THR B:330 , THR B:334 , LEU B:385 , SER B:391 , ARG B:396 , GLY B:454 , PHE B:455 , GLY B:456 , TRP B:457 , ARG B:460 , GLN B:461 , CYS B:462 , GLY B:464 , 2DC B:602BINDING SITE FOR RESIDUE HEM B 601
4AC4SOFTWAREPHE B:121 , GLY B:326 , SER B:391 , GLN B:395 , ILE B:500 , HOH B:536 , HOH B:584 , HEM B:601BINDING SITE FOR RESIDUE 2DC B 602
5AC5SOFTWAREGLY C:44 , CYS C:46 , GLY C:48 , CYS C:52 , CYS C:55 , LEU C:90 , CYS C:92BINDING SITE FOR RESIDUE FES C 150
6AC6SOFTWAREGLY D:44 , CYS D:46 , GLY D:48 , ALA D:51 , CYS D:52 , CYS D:55 , CYS D:92BINDING SITE FOR RESIDUE FES D 150

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3NA0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3NA0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (7, 14)

Asymmetric Unit (7, 14)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_065241L141WCP11A_HUMANDisease (AICSR)121912813A/BL141W
2UniProtVAR_016949A189VCP11A_HUMANDisease (AICSR)121912811A/BA189V
3UniProtVAR_065242L222PCP11A_HUMANDisease (AICSR)387906601A/BL222P
4UniProtVAR_013944E314KCP11A_HUMANPolymorphism6161A/BE314K
5UniProtVAR_016951R353WCP11A_HUMANDisease (AICSR)72547508A/BR353W
6UniProtVAR_065243A359VCP11A_HUMANDisease (AICSR)121912812A/BA359V
7UniProtVAR_065244V415ECP11A_HUMANDisease (AICSR)121912814A/BV415E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (7, 7)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_065241L141WCP11A_HUMANDisease (AICSR)121912813AL141W
2UniProtVAR_016949A189VCP11A_HUMANDisease (AICSR)121912811AA189V
3UniProtVAR_065242L222PCP11A_HUMANDisease (AICSR)387906601AL222P
4UniProtVAR_013944E314KCP11A_HUMANPolymorphism6161AE314K
5UniProtVAR_016951R353WCP11A_HUMANDisease (AICSR)72547508AR353W
6UniProtVAR_065243A359VCP11A_HUMANDisease (AICSR)121912812AA359V
7UniProtVAR_065244V415ECP11A_HUMANDisease (AICSR)121912814AV415E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (7, 7)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_065241L141WCP11A_HUMANDisease (AICSR)121912813BL141W
2UniProtVAR_016949A189VCP11A_HUMANDisease (AICSR)121912811BA189V
3UniProtVAR_065242L222PCP11A_HUMANDisease (AICSR)387906601BL222P
4UniProtVAR_013944E314KCP11A_HUMANPolymorphism6161BE314K
5UniProtVAR_016951R353WCP11A_HUMANDisease (AICSR)72547508BR353W
6UniProtVAR_065243A359VCP11A_HUMANDisease (AICSR)121912812BA359V
7UniProtVAR_065244V415ECP11A_HUMANDisease (AICSR)121912814BV415E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ADXPS00814 Adrenodoxin family, iron-sulfur binding region signature.ADX_HUMAN106-116
 
  2C:46-55
D:46-55
2CYTOCHROME_P450PS00086 Cytochrome P450 cysteine heme-iron ligand signature.CP11A_HUMAN455-464
 
  2A:455-464
B:455-464
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ADXPS00814 Adrenodoxin family, iron-sulfur binding region signature.ADX_HUMAN106-116
 
  1C:46-55
-
2CYTOCHROME_P450PS00086 Cytochrome P450 cysteine heme-iron ligand signature.CP11A_HUMAN455-464
 
  1A:455-464
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ADXPS00814 Adrenodoxin family, iron-sulfur binding region signature.ADX_HUMAN106-116
 
  1-
D:46-55
2CYTOCHROME_P450PS00086 Cytochrome P450 cysteine heme-iron ligand signature.CP11A_HUMAN455-464
 
  1-
B:455-464

(-) Exons   (0, 0)

(no "Exon" information available for 3NA0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:470
 aligned with CP11A_HUMAN | P05108 from UniProtKB/Swiss-Prot  Length:521

    Alignment length:470
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514
          CP11A_HUMAN    45 PRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPF 514
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee..eeeeee.hhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee.hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh..hhhhhhhhhhhhhhh.....eeee....eee..eee....eeeehhhhhhhh..........hhhhhh...............hhhhh..hhhhhhhhhhhhhhhhhhheeee........eee...eee.....eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------W-----------------------------------------------V--------------------------------P-------------------------------------------------------------------------------------------K--------------------------------------W-----V-------------------------------------------------------E--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTOCHROME-------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3na0 A  45 PRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPF 514
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514

Chain B from PDB  Type:PROTEIN  Length:470
 aligned with CP11A_HUMAN | P05108 from UniProtKB/Swiss-Prot  Length:521

    Alignment length:470
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514
          CP11A_HUMAN    45 PRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPF 514
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------p450-3na0B01 B:52-511                                                                                                                                                                                                                                                                                                                                                                                                                                                       --- Pfam domains (1)
           Pfam domains (2) -------p450-3na0B02 B:52-511                                                                                                                                                                                                                                                                                                                                                                                                                                                       --- Pfam domains (2)
         Sec.struct. author ..hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee..eeeeee.hhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeehhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh..hhhhhhhhhhhhhhh.....eeee....eee..eee....eeeehhhhhhhh..........hhhhhh...............hhhhh..hhhhhhhhhhhhhhhhhhheeeee.......eee...eee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------W-----------------------------------------------V--------------------------------P-------------------------------------------------------------------------------------------K--------------------------------------W-----V-------------------------------------------------------E--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTOCHROME-------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3na0 B  45 PRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPF 514
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514

Chain C from PDB  Type:PROTEIN  Length:28
 aligned with ADX_HUMAN | P10109 from UniProtKB/Swiss-Prot  Length:184

    Alignment length:51
                                   112       122       132       142       152 
            ADX_HUMAN   103 FGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQ 153
               SCOP domains d3na0c_ C: au               tomated mat        ches SCOP domains
               CATH domains --------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------- Pfam domains
         Sec.struct. author .............---------------hhhhhhhhh..--------.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE ---ADX        ------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                 3na0 C  43 FGACEGTLACSTC---------------TDEENDMLDLA--------LGCQ  93
                                    52  |      -        72        |-       |92 
                                       55              71        81       90   

Chain D from PDB  Type:PROTEIN  Length:28
 aligned with ADX_HUMAN | P10109 from UniProtKB/Swiss-Prot  Length:184

    Alignment length:51
                                   112       122       132       142       152 
            ADX_HUMAN   103 FGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQ 153
               SCOP domains d3na0d_ D: au               tomated mat        ches SCOP domains
               CATH domains --------------------------------------------------- CATH domains
           Pfam domains (1) Fer2-3na0D01                D:43-93                 Pfam domains (1)
           Pfam domains (2) Fer2-3na0D02                D:43-93                 Pfam domains (2)
         Sec.struct. author .............---------------hhhhhhhhh..--------.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE ---ADX        ------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                 3na0 D  43 FGACEGTLACSTC---------------TDEENDMLDLA--------LGCQ  93
                                    52  |      -        72        |-       |92 
                                       55              71        81       90   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NA0)

(-) Pfam Domains  (2, 4)

Asymmetric Unit
(-)
Clan: Fer2 (69)
(-)
Family: p450 (161)

(-) Gene Ontology  (31, 42)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CP11A_HUMAN | P05108)
molecular function
    GO:0008386    cholesterol monooxygenase (side-chain-cleaving) activity    Catalysis of the reaction: cholesterol + reduced adrenal ferredoxin + O2 = pregnenolone + 4-methylpentanal + oxidized adrenal ferredoxin + H2O.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016705    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
    GO:0016709    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from NADH or NADPH and one other donor, and one atom of oxygen is incorporated into one donor.
biological process
    GO:0006700    C21-steroid hormone biosynthetic process    The chemical reactions and pathways resulting in the formation of C21-steroid hormones, steroid compounds containing 21 carbons which function as hormones.
    GO:0008207    C21-steroid hormone metabolic process    The chemical reactions and pathways involving C21-steroid hormones, steroid compounds containing 21 carbons which function as hormones.
    GO:0071375    cellular response to peptide hormone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
    GO:0008203    cholesterol metabolic process    The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
    GO:0034650    cortisol metabolic process    The chemical reactions and pathways involving cortisol, the steroid hormone 11-beta-17,21-trihydroxypregn-4-ene-3,20-dione. Cortisol is synthesized from cholesterol in the adrenal gland and controls carbohydrate, fat and protein metabolism and has anti-inflammatory properties.
    GO:0006704    glucocorticoid biosynthetic process    The chemical reactions and pathways resulting in the formation of glucocorticoids, hormonal C21 corticosteroids synthesized from cholesterol.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0044550    secondary metabolite biosynthetic process    The chemical reactions and pathways resulting in the formation of secondary metabolites, the compounds that are not necessarily required for growth and maintenance of cells, and are often unique to a taxon.
    GO:0006694    steroid biosynthetic process    The chemical reactions and pathways resulting in the formation of steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus; includes de novo formation and steroid interconversion by modification.
    GO:0008202    steroid metabolic process    The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
    GO:0016125    sterol metabolic process    The chemical reactions and pathways involving sterols, steroids with one or more hydroxyl groups and a hydrocarbon side-chain in the molecule.
    GO:0042359    vitamin D metabolic process    The chemical reactions and pathways involving vitamin D, any of a group of related, fat-soluble compounds that are derived from delta-5,7 steroids and play a central role in calcium metabolism. Specific forms of vitamin D include calciferol (ergocalciferol; vitamin D2) and cholecalciferol (calciol; vitamin D3).
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005743    mitochondrial inner membrane    The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0031966    mitochondrial membrane    Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Chain C,D   (ADX_HUMAN | P10109)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0006700    C21-steroid hormone biosynthetic process    The chemical reactions and pathways resulting in the formation of C21-steroid hormones, steroid compounds containing 21 carbons which function as hormones.
    GO:0008203    cholesterol metabolic process    The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
    GO:0042446    hormone biosynthetic process    The chemical reactions and pathways resulting in the formation of any hormone, naturally occurring substances secreted by specialized cells that affects the metabolism or behavior of other cells possessing functional receptors for the hormone.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0044281    small molecule metabolic process    The chemical reactions and pathways involving small molecules, any low molecular weight, monomeric, non-encoded molecule.
    GO:0006694    steroid biosynthetic process    The chemical reactions and pathways resulting in the formation of steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus; includes de novo formation and steroid interconversion by modification.
    GO:0008202    steroid metabolic process    The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
    GO:0016125    sterol metabolic process    The chemical reactions and pathways involving sterols, steroids with one or more hydroxyl groups and a hydrocarbon side-chain in the molecule.
cellular component
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2DC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3na0)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3na0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ADX_HUMAN | P10109
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CP11A_HUMAN | P05108
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.15.6
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  613743
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ADX_HUMAN | P10109
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CP11A_HUMAN | P05108
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ADX_HUMAN | P101093n9y 3n9z 3na1 3p1m
        CP11A_HUMAN | P051083n9y 3n9z 3na1

(-) Related Entries Specified in the PDB File

3n9y 3n9z 3na1