|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3N7E) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3N7E) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3N7E) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3N7E) |
Exons (0, 0)| (no "Exon" information available for 3N7E) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:59 aligned with COPK_CUPMC | Q58AD3 from UniProtKB/Swiss-Prot Length:94 Alignment length:59 34 44 54 64 74 COPK_CUPMC 25 NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 83 SCOP domains ----------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 3n7e A 5 NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 63 14 24 34 44 54 Chain B from PDB Type:PROTEIN Length:59 aligned with COPK_CUPMC | Q58AD3 from UniProtKB/Swiss-Prot Length:94 Alignment length:59 34 44 54 64 74 COPK_CUPMC 25 NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 83 SCOP domains ----------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 3n7e B 5 NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 63 14 24 34 44 54
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3N7E) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3N7E) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3N7E) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (COPK_CUPMC | Q58AD3)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|