|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 3) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 3N7D) |
(no "Cis Peptide Bond" information available for 3N7D) |
(no "SAP(SNP)/Variant" information available for 3N7D) |
(no "PROSITE Motif" information available for 3N7D) |
(no "Exon" information available for 3N7D) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:59 aligned with COPK_CUPMC | Q58AD3 from UniProtKB/Swiss-Prot Length:94 Alignment length:59 34 44 54 64 74 COPK_CUPMC 25 NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 83 SCOP domains ----------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 3n7d A 5 NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 63 14 24 34 44 54 Chain B from PDB Type:PROTEIN Length:55 aligned with COPK_CUPMC | Q58AD3 from UniProtKB/Swiss-Prot Length:94 Alignment length:58 35 45 55 65 75 COPK_CUPMC 26 VVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 83 SCOP domains ---------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 3n7d B 6 VVKTYDLQDGSKVHVF---KMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD 63 15 | 25 35 45 55 21 25
|
(no "SCOP Domain" information available for 3N7D) |
(no "CATH Domain" information available for 3N7D) |
(no "Pfam Domain" information available for 3N7D) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (COPK_CUPMC | Q58AD3)
|
|
|
|
|
|
|