Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF (R)-OXIRANE-2-CARBOXYLATE INHIBITED CIS-CAAD
 
Authors :  Y. Guo, H. Serrano, S. R. Ernst, W. H. Johnson Jr. , M. L. Hackert, C. P. Wh
Date :  01 Apr 10  (Deposition) - 12 Jan 11  (Release) - 02 Feb 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Beta-Alpha-Beta Motif, Tautomerase, Dehalogenase, Cis-3-Chloroacrylic Acid Dehalogenase, Isomerase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Guo, H. Serrano, W. H. Johnson, S. Ernst, M. L. Hackert, C. P. Whitman
Crystal Structures Of Native And Inactivated Cis-3-Chloroacrylic Acid Dehalogenase: Implications For The Catalytic And Inactivation Mechanisms.
Bioorg. Chem. V. 39 1 2011
PubMed-ID: 21074239  |  Reference-DOI: 10.1016/J.BIOORG.2010.10.001

(-) Compounds

Molecule 1 - CIS-3-CHLOROACRYLIC ACID DEHALOGENASE
    Chains: A
    EC Number: 3.8.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET3
    Expression System Strain: BL21-GOLD(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 2-118
    Gene: CIS-CAAD
    Organism Scientific: CORYNEFORM BACTERIUM
    Organism Taxid: 1728

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (3x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1PR41Mod. Amino Acid1-[(2R)-2-CARBOXY-2-HYDROXYETHYL]-L-PROLINE
Biological Unit 1 (1, 3)
No.NameCountTypeFull Name
1PR43Mod. Amino Acid1-[(2R)-2-CARBOXY-2-HYDROXYETHYL]-L-PROLINE

(-) Sites  (0, 0)

(no "Site" information available for 3MF7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3MF7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3MF7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3MF7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3MF7)

(-) Exons   (0, 0)

(no "Exon" information available for 3MF7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:118
 aligned with Q6VPE5_9CORY | Q6VPE5 from UniProtKB/TrEMBL  Length:150

    Alignment length:118
                                    11        21        31        41        51        61        71        81        91       101       111        
         Q6VPE5_9CORY     2 PVYMVYVSQDRLTPSAKHAVAKAITDAHRGLTGTQHFLAQVNFQEQPAGNVFLGGVQQGGDTIFVHGLHREGRSADLKGQLAQRIVDDVSVAAEIDRKHIWVYFGEMPAQQMVEYGRF 119
               SCOP domains ---------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------Tautomerase-3mf7A01 A:64-118                            Pfam domains
         Sec.struct. author .eeeeeee....hhhhhhhhhhhhhhhhhhh........eeeeeee.....ee..ee.....eeeeeeee...hhhhhhhhhhhhhhhhhhhh..hhh.eeeeeeeehhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 3mf7 A   1 pVYMVYVSQDRLTPSAKHAVAKAITDAHRGLTGTQHFLAQVNFQEQPAGNVFLGGVQQGGDTIFVHGLHREGRSADLKGQLAQRIVDDVSVAAEIDRKHIWVYFGEMPAQQMVEYGRF 118
                            |       10        20        30        40        50        60        70        80        90       100       110        
                            |                                                                                                                     
                            1-PR4
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3MF7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3MF7)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: MIF (36)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3MF7)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PR4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3mf7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3mf7)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3mf7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6VPE5_9CORY | Q6VPE5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.8.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6VPE5_9CORY | Q6VPE5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6VPE5_9CORY | Q6VPE5: 2flt 2flz 3mf8

(-) Related Entries Specified in the PDB File

3mf8