Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  PROTEIN STRUCTURE OF TYPE III PLASMID SEGREGATION TUBR
 
Authors :  M. A. Schumacher, L. Ni
Date :  21 Mar 10  (Deposition) - 07 Jul 10  (Release) - 21 Jul 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Tubr, Winged Helix-Turn-Helix, Plasmid Segregation, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Ni, W. Xu, M. Kumaraswami, M. A. Schumacher
From The Cover: Plasmid Protein Tubr Uses A Distinct Mode O Hth-Dna Binding And Recruits The Prokaryotic Tubulin Homolo Tubz To Effect Dna Partition.
Proc. Natl. Acad. Sci. Usa V. 107 11763 2010
PubMed-ID: 20534443  |  Reference-DOI: 10.1073/PNAS.1003817107

(-) Compounds

Molecule 1 - PUTATIVE DNA-BINDING PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B(+)
    Expression System StrainBL21-GOLD(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GenePBT157
    Organism ScientificBACILLUS THURINGIENSIS
    Organism Taxid1430
    StrainSEROVAR ISRAELENSIS

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3M9A)

(-) Sites  (0, 0)

(no "Site" information available for 3M9A)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3M9A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3M9A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3M9A)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3M9A)

(-) Exons   (0, 0)

(no "Exon" information available for 3M9A)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with Q8KNP2_BACTI | Q8KNP2 from UniProtKB/TrEMBL  Length:104

    Alignment length:93
                                    15        25        35        45        55        65        75        85        95   
          Q8KNP2_BACTI    6 FYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKA 98
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhh.hhhhhhhhhhh..........hhhhhhhhh..hhhhhhhhhhhhhhh..eeeeee..eeeeeehhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                  3m9a A  6 FYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKA 98
                                    15        25        35        45        55        65        75        85        95   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3M9A)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3M9A)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3M9A)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q8KNP2_BACTI | Q8KNP2)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3m9a)
 
  Sites
(no "Sites" information available for 3m9a)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3m9a)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3m9a
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8KNP2_BACTI | Q8KNP2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8KNP2_BACTI | Q8KNP2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8KNP2_BACTI | Q8KNP23m8e 3m8f 4aso 4ass

(-) Related Entries Specified in the PDB File

3m8e