|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric/Biological Unit (2, 5) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3M97) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3M97) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3M97) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3M97) |
Sequences/Alignments
Asymmetric/Biological UnitChain X from PDB Type:PROTEIN Length:118 aligned with CY552_PARDE | P54820 from UniProtKB/Swiss-Prot Length:176 Alignment length:140 46 56 66 76 86 96 106 116 126 136 146 156 166 176 CY552_PARDE 37 SGHGAEGEEHAQAYTYPVESAGGAEGEAVDEGPDFATVLASADPAAGEKVFGKCKACHKLDGNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLEGQQ 176 SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------Cytochrom_C-3m97X01 X:44-140 Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------------------CYTC PDB: X:42-140 UniProt: 78-176 PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3m97 X 1 MGHGAEGEEHA----------------------DFATVLASADPAAGEKVFGKCKACHKLDGNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLEGQQ 140 10| - - | 40 50 60 70 80 90 100 110 120 130 140 11 34
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3M97) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3M97) |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain X (CY552_PARDE | P54820)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|