|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric Unit (3, 3) Biological Unit 1 (2, 6) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3M1X) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3M1X) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3M1X) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3M1X) |
Exons (0, 0)| (no "Exon" information available for 3M1X) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:126 aligned with C4LXT9_ENTHI | C4LXT9 from UniProtKB/TrEMBL Length:127 Alignment length:126 11 21 31 41 51 61 71 81 91 101 111 121 C4LXT9_ENTHI 2 SKLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL 127 SCOP domains d3m1xa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains -------Ribonuc_L-PSP-3m1xA01 A:9-127 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 3m1x A 2 SKLTVVASPLAPEAVGAYSQAIICNGmVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL 127 11 21 | 31 41 51 61 71 81 91 101 111 121 28-MHO
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3M1X) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3M1X)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|