3LQ5 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF CDK9/CYCLINT IN COMPLEX WITH S-CR8

Authors :   A. J. Hole, J. A. Endicott, S. Baumli

Date :   08 Feb 10 (Deposition) - 19 Jan 11 (Release) - 25 Apr 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Transcriptional Cdk-Cyclin Complex, Phosphorylated, Atp-Binding, Kinase, Nucleotide-Binding, Nucleus, Phosphoprotein, Serine/Threonine-Protein Kinase, Transcription Regulation, Transferase, Cell Cycle, Cell Division, Host-Virus Interaction, , Transcription-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Bettayeb, D. Baunbak, C. Delehouze, N. Loaec, A. J. Hole, S. Baumli, J. A. Endicott, S. Douc-Rasy, J. Benard, N. Oumata, H. Galons, L. Meije
Cdk Inhibitors Roscovitine And Cr8 Trigger Mcl-1 Down-Regulation And Apoptotic Cell Death In Neuroblastoma Cells
Genes Cancer V. 1 369 2010
PubMed-ID: 21779453 | Reference-DOI: 10.1177/1947601910369817

Molecule 1 - CELL DIVISION PROTEIN KINASE 9
	Chains	:	A
	EC Number	:	2.7.11.22, 2.7.11.23
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Plasmid	:	PVL1392
	Expression System Strain	:	SF9
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULO VIRUS
	Fragment	:	KINASE DOMAIN, UNP RESIDUES 2-330
	Gene	:	CDC2L4, CDK9
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYCLIN-DEPENDENT KINASE 9, SERINE/THREONINE-PROTEIN KINASE PITALRE, CELL DIVISION CYCLE 2-LIKE PROTEIN KINASE 4, C-2K

Molecule 2 - CYCLIN-T1
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Plasmid	:	PVL1392
	Expression System Strain	:	SF9
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULO VIRUS
	Fragment	:	CYCLIN DOMAIN, UNP RESIDUES 2-259
	Gene	:	CCNT1
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYCLIN-T, CYCT1

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 2)

No.	Name	Count	Type	Full Name
1	SLQ	1	Ligand/Ion	(2S)-2-({9-(1-METHYLETHYL)-6-[(4-PYRIDIN-2-YLBENZYL)AMINO]-9H-PURIN-2-YL}AMINO)BUTAN-1-OL
2	TPO	1	Mod. Amino Acid	PHOSPHOTHREONINE

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:25 , ALA A:46 , VAL A:79 , PHE A:103 , ASP A:104 , PHE A:105 , CYS A:106 , GLU A:107 , HIS A:108 , ASN A:154 , LEU A:156 , ASP A:167	BINDING SITE FOR RESIDUE SLQ A 331

(no "SS Bond" information available for 3LQ5)

Asymmetric/Biological Unit

No.	Residues
1	Gly A:26	-	Gln A:27
2	Phe A:30	-	Gly A:31
3	Asp A:318	-	Pro A:319

Asymmetric/Biological Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_041982	F	59	L	CDK9_HUMAN	Polymorphism	55640715	A	F	59	L
2	UniProt	VAR_013456	G	231	A	CDK9_HUMAN	Polymorphism	---	A	G	231	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	CDK9_HUMAN	25-48	1	A:25-48
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	CDK9_HUMAN	145-157	1	A:145-157

Asymmetric/Biological Unit (15, 15)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000261900	1	ENSE00001164718	chr12:49110781-49110298	484	CCNT1_HUMAN	1-54	54	1	B:9-54	46
1.2	ENST00000261900	2	ENSE00000914192	chr12:49108307-49108226	82	CCNT1_HUMAN	54-81	28	1	B:54-81	28
1.3	ENST00000261900	3	ENSE00000938798	chr12:49099679-49099551	129	CCNT1_HUMAN	82-124	43	1	B:82-124	43
1.4	ENST00000261900	4	ENSE00000938799	chr12:49094856-49094796	61	CCNT1_HUMAN	125-145	21	1	B:125-145	21
1.5	ENST00000261900	5	ENSE00000938800	chr12:49093623-49093561	63	CCNT1_HUMAN	145-166	22	1	B:145-166	22
1.6	ENST00000261900	6	ENSE00000938801	chr12:49091966-49091921	46	CCNT1_HUMAN	166-181	16	1	B:166-181	16
1.8	ENST00000261900	8	ENSE00000938802	chr12:49089945-49089782	164	CCNT1_HUMAN	181-236	56	1	B:181-236	56
1.9	ENST00000261900	9	ENSE00000938803	chr12:49089612-49089542	71	CCNT1_HUMAN	236-259	24	1	B:236-259	24
1.10	ENST00000261900	10	ENSE00001164708	chr12:49088219-49086752	1468	CCNT1_HUMAN	260-726	467	0	-	-

2.1c	ENST00000373264	1c	ENSE00001251705	chr9:130548328-130548519	192	CDK9_HUMAN	1-31	31	1	A:6-31 (gaps)	26
2.2a	ENST00000373264	2a	ENSE00000984615	chr9:130548980-130549061	82	CDK9_HUMAN	31-58	28	1	A:31-58	28
2.3c	ENST00000373264	3c	ENSE00000984616	chr9:130549797-130549887	91	CDK9_HUMAN	59-89	31	1	A:59-88	30
2.4	ENST00000373264	4	ENSE00000984617	chr9:130550226-130550392	167	CDK9_HUMAN	89-144	56	1	A:97-144	48
2.5b	ENST00000373264	5b	ENSE00000984618	chr9:130550493-130550664	172	CDK9_HUMAN	145-202	58	1	A:145-202 (gaps)	58
2.6c	ENST00000373264	6c	ENSE00000984619	chr9:130550823-130550971	149	CDK9_HUMAN	202-251	50	1	A:202-251	50
2.7c	ENST00000373264	7c	ENSE00001814236	chr9:130551457-130553066	1610	CDK9_HUMAN	252-372	121	1	A:252-327	76

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:308
 aligned with CDK9_HUMAN | P50750 from UniProtKB/Swiss-Prot  Length:372

    Alignment length:322
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325  
           CDK9_HUMAN     6 DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM 327
               SCOP domains d3lq5a_ A: Cell divisi  on protein kinase 9, CDK9                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------Pkinase-3  lq5A01 A:19-315                                                                                                                                                                                                                                                                               ------------ Pfam domains
         Sec.struct. author ........ee...eeeeeeee.--...eeeeee.....eeeeeee.........hhhhhhhhhhhhhh.......eeeeee..--------..eeeeee...eehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee....----.........hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh.........hhhhh..............hhhhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhh................ Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------L---------------------------------------------------------------------------------------------------------------------------------------------------------------------------A------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------PROTEIN_KINASE_ATP      ------------------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1c UniProt: 1-31   ---------------------------Exon 2.3c  PDB: A:59-88        -------------------------------------------------------Exon 2.5b  PDB: A:145-202 (gaps) UniProt: 145-202         -------------------------------------------------Exon 2.7c  PDB: A:252-327 UniProt: 252-372 [INCOMPLETE]                      Transcript 2 (1)
           Transcript 2 (2) -------------------------Exon 2.2a  PDB: A:31-58     ------------------------------Exon 2.4  PDB: A:97-144 UniProt: 89-144 [INCOMPLETE]    ---------------------------------------------------------Exon 2.6c  PDB: A:202-251 UniProt: 202-251        ---------------------------------------------------------------------------- Transcript 2 (2)
                 3lq5 A   6 DSVECPFCDEVSKYEKLAKIGQ--FGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK--------GSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLA----PNRYtNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM 327
                                    15        25 |  |   35        45        55        65        75        85  |      - |     105       115       125       135       145       155       165       175 |    |185|      195       205       215       225       235       245       255       265       275       285       295       305       315       325  
                                                27 30                                                        88       97                                                                             177  182   |                                                                                                                                             
                                                                                                                                                                                                              186-TPO

Chain B from PDB  Type:PROTEIN  Length:251
 aligned with CCNT1_HUMAN | O60563 from UniProtKB/Swiss-Prot  Length:726

    Alignment length:251
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258 
          CCNT1_HUMAN     9 NKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWR 259
               SCOP domains d3lq5b1 B:9-150 automated matches                                                                                                             d3lq5b2 B:151-259 automated matches                                                                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Cyclin_N-3lq5B01 B:9-149                                                                                                                     -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh............hhhhh....hhhhhhhhhhhhhhhhhhh..hhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:9-54 UniProt: 1-54           ---------------------------Exon 1.3  PDB: B:82-124 UniProt: 82-124    Exon 1.4             --------------------Exon 1.6        ------------------------------------------------------Exon 1.9  PDB: B:236-259 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.2  PDB: B:54-81      ---------------------------------------------------------------Exon 1.5              --------------Exon 1.8  PDB: B:181-236 UniProt: 181-236               ----------------------- Transcript 1 (2)
                 3lq5 B   9 NKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTRFPGNSVAPAALFLAAKVEGQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHELLQILEKTPNRLKRIWNWR 259
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Cyclin-like (137)

Superfamily: Cyclin-like (137)

Family: automated matches (7)

Protein domain: automated matches (7)

Human (Homo sapiens) [TaxId: 9606] (7)

1a	d3lq5b1	B:9-150
1b	d3lq5b2	B:151-259

Class: Alpha and beta proteins (a+b) (23004)

Fold: Protein kinase-like (PK-like) (2589)

Superfamily: Protein kinase-like (PK-like) (2589)

Family: Protein kinases, catalytic subunit (1977)

Protein domain: Cell division protein kinase 9, CDK9 (6)

Human (Homo sapiens) [TaxId: 9606] (6)

d3lq5a_

(no "CATH Domain" information available for 3LQ5)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Cyclin (63)

Family: Cyclin_N (51)

Homo sapiens (Human) (43)

Cyclin_N-3lq5B01

B:9-149

Clan: PKinase (934)

Family: Pkinase (680)

Homo sapiens (Human) (521)

Pkinase-3lq5A01

A:19-315

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (CDK9_HUMAN | P50750)

molecular function
	GO:0097322	7SK snRNA binding	Interacting selectively and non-covalently with a 7SK small nuclear RNA (7SK snRNA).
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	Catalysis of the reaction: ATP + (DNA-directed RNA polymerase II) = ADP + phospho-(DNA-directed RNA polymerase II); phosphorylation occurs on residues in the carboxy-terminal domain (CTD) repeats.
	GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for transcription factors of the RNA polymerase II basal transcription machinery.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0004693	cyclin-dependent protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate. This reaction requires the binding of a regulatory cyclin subunit and full activity requires stimulatory phosphorylation by a CDK-activating kinase (CAK).
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0017069	snRNA binding	Interacting selectively and non-covalently with a small nuclear RNA (snRNA).
	GO:0001223	transcription coactivator binding	Interacting selectively and non-covalently with a transcription coactivator, any protein involved in positive regulation of transcription via protein-protein interactions with transcription factors and other proteins that positively regulate transcription. Transcription coactivators do not bind DNA directly, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0071345	cellular response to cytokine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0071157	negative regulation of cell cycle arrest	Any process that decreases the rate, frequency, or extent of cell cycle arrest, the process in which the cell cycle is halted during one of the normal phases.
	GO:1900364	negative regulation of mRNA polyadenylation	Any process that stops, prevents or reduces the frequency, rate or extent of mRNA polyadenylation.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0010613	positive regulation of cardiac muscle hypertrophy	Any process that increases the rate, frequency or extent of the enlargement or overgrowth of all or part of the heart due to an increase in size (not length) of individual cardiac muscle fibers, without cell division.
	GO:2001168	positive regulation of histone H2B ubiquitination	Any process that activates or increases the frequency, rate or extent of histone H2B ubiquitination.
	GO:0033129	positive regulation of histone phosphorylation	Any process that activates or increases the frequency, rate or extent of the addition of one or more phosphate groups to a histone protein.
	GO:1903839	positive regulation of mRNA 3'-UTR binding	Any process that activates or increases the frequency, rate or extent of mRNA 3'-UTR binding.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0050434	positive regulation of viral transcription	Any process that activates or increases the frequency, rate or extent of viral transcription.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0006282	regulation of DNA repair	Any process that modulates the frequency, rate or extent of DNA repair.
	GO:0031056	regulation of histone modification	Any process that modulates the frequency, rate or extent of the covalent alteration of a histone.
	GO:0007346	regulation of mitotic cell cycle	Any process that modulates the rate or extent of progress through the mitotic cell cycle.
	GO:0051147	regulation of muscle cell differentiation	Any process that modulates the frequency, rate or extent of muscle cell differentiation.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0031297	replication fork processing	The process in which a DNA replication fork that has stalled is restored to a functional state and replication is restarted. The stalling may be due to DNA damage, DNA secondary structure, bound proteins, dNTP shortage, or other causes.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0042795	snRNA transcription from RNA polymerase II promoter	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0016605	PML body	A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
	GO:0008024	cyclin/CDK positive transcription elongation factor complex	A transcription elongation factor complex that facilitates the transition from abortive to productive elongation by phosphorylating the CTD domain of the large subunit of DNA-directed RNA polymerase II, holoenzyme. Contains a cyclin and a cyclin-dependent protein kinase catalytic subunit.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0008023	transcription elongation factor complex	Any protein complex that interacts with RNA polymerase II to increase (positive transcription elongation factor) or reduce (negative transcription elongation factor) the rate of transcription elongation.

Chain B (CCNT1_HUMAN | O60563)

molecular function
	GO:0097322	7SK snRNA binding	Interacting selectively and non-covalently with a 7SK small nuclear RNA (7SK snRNA).
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0070063	RNA polymerase binding	Interacting selectively and non-covalently with an RNA polymerase molecule or complex.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	Modulates the activity of a cyclin-dependent protein serine/threonine kinase, enzymes of the protein kinase family that are regulated through association with cyclins and other proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0017069	snRNA binding	Interacting selectively and non-covalently with a small nuclear RNA (snRNA).
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:1900364	negative regulation of mRNA polyadenylation	Any process that stops, prevents or reduces the frequency, rate or extent of mRNA polyadenylation.
	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that activates or increases the frequency, rate or extent of CDK activity.
	GO:1901409	positive regulation of phosphorylation of RNA polymerase II C-terminal domain	Any process that activates or increases the frequency, rate or extent of phosphorylation of RNA polymerase II C-terminal domain.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0050434	positive regulation of viral transcription	Any process that activates or increases the frequency, rate or extent of viral transcription.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that modulates the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0042795	snRNA transcription from RNA polymerase II promoter	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0008024	cyclin/CDK positive transcription elongation factor complex	A transcription elongation factor complex that facilitates the transition from abortive to productive elongation by phosphorylating the CTD domain of the large subunit of DNA-directed RNA polymerase II, holoenzyme. Contains a cyclin and a cyclin-dependent protein kinase catalytic subunit.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SLQ	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TPO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asp A:318 - Pro A:319	[ RasMol ]
		Gly A:26 - Gln A:27	[ RasMol ]
		Phe A:30 - Gly A:31	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3lq5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CCNT1_HUMAN \| O60563
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CDK9_HUMAN \| P50750
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.11.22
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	2.7.11.23
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CCNT1_HUMAN \| O60563
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CDK9_HUMAN \| P50750
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (2, 2)

Exons (15, 15)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 3)

CATH Domains (0, 0)

Pfam Domains (2, 2)

Gene Ontology (60, 79)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File