3LJR - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   GLUTATHIONE TRANSFERASE (THETA CLASS) FROM HUMAN IN COMPLEX WITH THE GLUTATHIONE CONJUGATE OF 1-MENAPHTHYL SULFATE

Authors :   J. Rossjohn, W. J. Mckinstry, A. J. Oakley, D. Verger, J. Flanagan, G. Chelvanayagam, K. L. Tan, P. G. Board, M. W. Parker

Date :   08 Mar 98 (Deposition) - 23 Mar 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.30

Chains :   Asym./Biol. Unit : A,B

Keywords :   Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Rossjohn, W. J. Mckinstry, A. J. Oakley, D. Verger, J. Flanagan, G. Chelvanayagam, K. L. Tan, P. G. Board, M. W. Parker
Human Theta Class Glutathione Transferase: The Crystal Structure Reveals A Sulfate-Binding Pocket Within A Buried Active Site.
Structure V. 6 309 1998
PubMed-ID: 9551553 | Reference-DOI: 10.1016/S0969-2126(98)00034-3
(for further references see the PDB file header)

Molecule 1 - GLUTATHIONE S-TRANSFERASE
	Cellular Location	:	CYTOPLASM
	Chains	:	A, B
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HGST T2-2

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 4)

No.	Name	Count	Type	Full Name
1	GGC	2	Ligand/Ion	1-MENAPHTHYL GLUTATHIONE CONJUGATE
2	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:12 , GLY A:111 , TRP A:115 , ARG A:239 , GGC A:301	BINDING SITE FOR RESIDUE SO4 A 245
2	AC2	SOFTWARE	GLN B:12 , ARG B:107 , GLY B:108 , TRP B:115 , ARG B:239 , GGC B:301 , HOH B:303	BINDING SITE FOR RESIDUE SO4 B 302
3	AC3	SOFTWARE	VAL A:10 , SER A:11 , GLN A:12 , PRO A:13 , HIS A:40 , LYS A:41 , LYS A:53 , LEU A:54 , PRO A:55 , GLU A:66 , SER A:67 , ARG A:107 , TRP A:115 , LEU A:119 , ALA A:235 , SO4 A:245 , ASP B:104	BINDING SITE FOR RESIDUE GGC A 301
4	AC4	SOFTWARE	ASP A:104 , VAL B:10 , SER B:11 , GLN B:12 , PRO B:13 , LEU B:35 , HIS B:40 , LYS B:41 , GLY B:52 , LYS B:53 , LEU B:54 , PRO B:55 , GLU B:66 , SER B:67 , ARG B:107 , TRP B:115 , LEU B:119 , SO4 B:302	BINDING SITE FOR RESIDUE GGC B 301

(no "SS Bond" information available for 3LJR)

Asymmetric/Biological Unit

No.	Residues
1	Leu A:54	-	Pro A:55
2	Leu B:54	-	Pro B:55

Asymmetric/Biological Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033982	M	139	I	GSTT2_HUMAN	Polymorphism	1622002	A/B	M	139	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTT2_HUMAN	1-82	2	A:1-82 B:1-82
1	GST_NTER	PS50404		GST2_HUMAN	1-82	2	A:1-82 B:1-82
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTT2_HUMAN	88-224	2	A:88-224 B:88-224
2	GST_CTER	PS50405		GST2_HUMAN	88-224	2	A:88-224 B:88-224

Asymmetric/Biological Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000290765	1a	ENSE00001833725	chr22:24303373-24303207	167	GSTT2_HUMAN	1-38	38	2	A:1-38 B:1-38	38 38
1.2	ENST00000290765	2	ENSE00001749600	chr22:24302568-24302481	88	GSTT2_HUMAN	38-67	30	2	A:38-67 B:38-67	30 30
1.3	ENST00000290765	3	ENSE00001734445	chr22:24300888-24300738	151	GSTT2_HUMAN	67-117	51	2	A:67-117 B:67-117	51 51
1.4b	ENST00000290765	4b	ENSE00001727999	chr22:24300645-24300472	174	GSTT2_HUMAN	118-175	58	2	A:118-175 B:118-175	58 58
1.5b	ENST00000290765	5b	ENSE00001883656	chr22:24300119-24299601	519	GSTT2_HUMAN	176-244	69	2	A:176-244 B:176-244	69 69

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:244
 aligned with GST2_HUMAN | P0CG29 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240    
           GST2_HUMAN     1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
               SCOP domains d3ljra2 A:1-79 Class theta GST                                                 d3ljra1 A:80-244 Class theta GST                                                                                                                                      SCOP domains
               CATH domains 3ljrA01 A:1-82 Glutaredoxin                                                       3ljrA02 A:83-244  [code=1.20.1050.10, no name defined]                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....hhhhhhhhhhhh....eeeee......hhh.hhhh.........eeee..eee..hhhhhhhhhhh...........hhhhhhhhhhhhhhhhh......hhhhhh.hhhhh.....hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.hhhhhhh.hhhhhhhhhhh........hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------I--------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) GST_NTER  PDB: A:1-82 UniProt: 1-82                                               ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (1) ---------------------------------------------------------------------------------------GST_CTER  PDB: A:88-224 UniProt: 88-224                                                                                                  -------------------- PROSITE (1)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ljr A   1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain A from PDB  Type:PROTEIN  Length:244
 aligned with GSTT2_HUMAN | P0CG30 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240    
          GSTT2_HUMAN     1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
               SCOP domains d3ljra2 A:1-79 Class theta GST                                                 d3ljra1 A:80-244 Class theta GST                                                                                                                                      SCOP domains
               CATH domains 3ljrA01 A:1-82 Glutaredoxin                                                       3ljrA02 A:83-244  [code=1.20.1050.10, no name defined]                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....hhhhhhhhhhhh....eeeee......hhh.hhhh.........eeee..eee..hhhhhhhhhhh...........hhhhhhhhhhhhhhhhh......hhhhhh.hhhhh.....hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.hhhhhhh.hhhhhhhhhhh........hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------I--------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) GST_NTER  PDB: A:1-82 UniProt: 1-82                                               ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------GST_CTER  PDB: A:88-224 UniProt: 88-224                                                                                                  -------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1a  PDB: A:1-38 UniProt: 1-38  ----------------------------Exon 1.3  PDB: A:67-117 UniProt: 67-117            Exon 1.4b  PDB: A:118-175 UniProt: 118-175                Exon 1.5b  PDB: A:176-244 UniProt: 176-244                            Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2  PDB: A:38-67        --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3ljr A   1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain B from PDB  Type:PROTEIN  Length:244
 aligned with GST2_HUMAN | P0CG29 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240    
           GST2_HUMAN     1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
               SCOP domains d3ljrb2 B:1-79 Class theta GST                                                 d3ljrb1 B:80-244 Class theta GST                                                                                                                                      SCOP domains
               CATH domains 3ljrB01 B:1-82 Glutaredoxin                                                       3ljrB02 B:83-244  [code=1.20.1050.10, no name defined]                                                                                                             CATH domains
           Pfam domains (1) ---------GST_N-3ljrB03 B:10-75                                             -------------------GST_C-3ljrB01 B:95-200                                                                                    -------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------GST_N-3ljrB04 B:10-75                                             -------------------GST_C-3ljrB02 B:95-200                                                                                    -------------------------------------------- Pfam domains (2)
         Sec.struct. author ..eeeee....hhhhhhhhhhhh....eeeee......hhh.hhhh.........eeee..eee..hhhhhhhhhhh...........hhhhhhhhhhhhhhhhh......hhhhhh.hhhhh.....hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.hhhhhhh.hhhhhhhhhhh........hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------I--------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) GST_NTER  PDB: B:1-82 UniProt: 1-82                                               ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (1) ---------------------------------------------------------------------------------------GST_CTER  PDB: B:88-224 UniProt: 88-224                                                                                                  -------------------- PROSITE (1)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ljr B   1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain B from PDB  Type:PROTEIN  Length:244
 aligned with GSTT2_HUMAN | P0CG30 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240    
          GSTT2_HUMAN     1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
               SCOP domains d3ljrb2 B:1-79 Class theta GST                                                 d3ljrb1 B:80-244 Class theta GST                                                                                                                                      SCOP domains
               CATH domains 3ljrB01 B:1-82 Glutaredoxin                                                       3ljrB02 B:83-244  [code=1.20.1050.10, no name defined]                                                                                                             CATH domains
           Pfam domains (1) ---------GST_N-3ljrB03 B:10-75                                             -------------------GST_C-3ljrB01 B:95-200                                                                                    -------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------GST_N-3ljrB04 B:10-75                                             -------------------GST_C-3ljrB02 B:95-200                                                                                    -------------------------------------------- Pfam domains (2)
         Sec.struct. author ..eeeee....hhhhhhhhhhhh....eeeee......hhh.hhhh.........eeee..eee..hhhhhhhhhhh...........hhhhhhhhhhhhhhhhh......hhhhhh.hhhhh.....hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.hhhhhhh.hhhhhhhhhhh........hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------I--------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) GST_NTER  PDB: B:1-82 UniProt: 1-82                                               ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------GST_CTER  PDB: B:88-224 UniProt: 88-224                                                                                                  -------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1a  PDB: B:1-38 UniProt: 1-38  ----------------------------Exon 1.3  PDB: B:67-117 UniProt: 67-117            Exon 1.4b  PDB: B:118-175 UniProt: 118-175                Exon 1.5b  PDB: B:176-244 UniProt: 176-244                            Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2  PDB: B:38-67        --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3ljr B   1 MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Human (Homo sapiens) (186)

1a	3ljrA01	A:1-82
1b	3ljrB01	B:1-82

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 (267)

Homologous Superfamily: [code=1.20.1050.10, no name defined] (249)

Human (Homo sapiens) (119)

2a	3ljrA02	A:83-244
2b	3ljrB02	B:83-244

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: GST_C (118)

Family: GST_C (102)

Homo sapiens (Human) (47)

1a	GST_C-3ljrB01	B:95-200
1b	GST_C-3ljrB02	B:95-200

Clan: Thioredoxin (367)

Family: GST_N (88)

Homo sapiens (Human) (45)

2a	GST_N-3ljrB03	B:10-75
2b	GST_N-3ljrB04	B:10-75

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (GSTT2_HUMAN | P0CG30)

molecular function
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Chain A,B (GST2_HUMAN | P0CG29)

molecular function
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GGC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:54 - Pro A:55	[ RasMol ]
		Leu B:54 - Pro B:55	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ljr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GST2_HUMAN \| P0CG29
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GSTT2_HUMAN \| P0CG30
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GST2_HUMAN \| P0CG29
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GSTT2_HUMAN \| P0CG30
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GST2_HUMAN \| P0CG29	:	1ljr 2ljr 4mpf 4mpg
	GSTT2_HUMAN \| P0CG30	:	1ljr 2ljr 4mpg

(no "Related Entries Specified in the PDB File" available for 3LJR)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (2, 4)

Exons (5, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (7, 12)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File