|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3KU7) |
(no "Site" information available for 3KU7) |
(no "SS Bond" information available for 3KU7) |
(no "Cis Peptide Bond" information available for 3KU7) |
(no "SAP(SNP)/Variant" information available for 3KU7) |
(no "PROSITE Motif" information available for 3KU7) |
(no "Exon" information available for 3KU7) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:61 aligned with MINE_HELPY | O25099 from UniProtKB/Swiss-Prot Length:77 Alignment length:64 22 32 42 52 62 72 MINE_HELPY 13 AATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILP 76 SCOP domains ---------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 3ku7 A 13 AATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTL---QSVETIEVEIILP 76 22 32 42 52 | - | 72 60 64 Chain B from PDB Type:PROTEIN Length:58 aligned with MINE_HELPY | O25099 from UniProtKB/Swiss-Prot Length:77 Alignment length:62 25 35 45 55 65 75 MINE_HELPY 16 ATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR 77 SCOP domains -------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains (1) MinE-3ku7B01 B:16-77 Pfam domains (1) Pfam domains (2) MinE-3ku7B02 B:16-77 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 3ku7 B 16 ATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTL----SVETIEVEIILPR 77 25 35 45 55 | 65 75 60 65
|
(no "SCOP Domain" information available for 3KU7) |
(no "CATH Domain" information available for 3KU7) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (MINE_HELPY | O25099)
|
|
|
|
|
|
|