|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3MCD) |
(no "Site" information available for 3MCD) |
(no "SS Bond" information available for 3MCD) |
(no "Cis Peptide Bond" information available for 3MCD) |
(no "SAP(SNP)/Variant" information available for 3MCD) |
(no "PROSITE Motif" information available for 3MCD) |
(no "Exon" information available for 3MCD) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:56 aligned with MINE_HELPY | O25099 from UniProtKB/Swiss-Prot Length:77 Alignment length:61 25 35 45 55 65 75 MINE_HELPY 16 ATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILP 76 SCOP domains ------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 3mcd A 16 ATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTL-----VETIEVEIILP 76 25 35 45 55 | -| 75 60 66 Chain B from PDB Type:PROTEIN Length:55 aligned with MINE_HELPY | O25099 from UniProtKB/Swiss-Prot Length:77 Alignment length:61 25 35 45 55 65 75 MINE_HELPY 16 ATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILP 76 SCOP domains ------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 3mcd B 16 ATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTL------ETIEVEIILP 76 25 35 45 55 | - | 75 60 67
|
(no "SCOP Domain" information available for 3MCD) |
(no "CATH Domain" information available for 3MCD) |
(no "Pfam Domain" information available for 3MCD) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (MINE_HELPY | O25099)
|
|
|
|
|
|
|