|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3KMJ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3KMJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3KMJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3KMJ) |
Exons (0, 0)| (no "Exon" information available for 3KMJ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:119 aligned with O41094_PBCV1 | O41094 from UniProtKB/TrEMBL Length:119 Alignment length:119 10 20 30 40 50 60 70 80 90 100 110 O41094_PBCV1 1 MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN 119 SCOP domains d3kmja_ A: Viral histone H3 Lysine 27 Methyltransferase SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------SET-3kmjA01 A:43-106 ------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 3kmj A 1 MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN 119 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3KMJ) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (O41094_PBCV1 | O41094)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|