|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric/Biological Unit (3, 5) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3KMA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3KMA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3KMA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3KMA) |
Exons (0, 0)| (no "Exon" information available for 3KMA) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:105 aligned with O41094_PBCV1 | O41094 from UniProtKB/TrEMBL Length:119 Alignment length:105 10 20 30 40 50 60 70 80 90 100 O41094_PBCV1 1 MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISY 105 SCOP domains d3kmaa_ A: Viral histone H3 Lysine 27 Methyltransferase SCOP domains CATH domains --------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 3kma A 1 MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISY 105 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:105 aligned with O41094_PBCV1 | O41094 from UniProtKB/TrEMBL Length:119 Alignment length:105 10 20 30 40 50 60 70 80 90 100 O41094_PBCV1 1 MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISY 105 SCOP domains d3kmab_ B: Viral histone H3 Lysine 27 Methyltransferase SCOP domains CATH domains --------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) ------------------------------------------SET-3kmaB01 B:43-105 Pfam domains (1) Pfam domains (2) ------------------------------------------SET-3kmaB02 B:43-105 Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 3kma B 1 MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISY 105 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3KMA) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (O41094_PBCV1 | O41094)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|