3JYM - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE 3 FKBP DOMAINS OF WHEAT FKBP73

Authors :   O. Dym, A. Breiman, Israel Structural Proteomics Center (Ispc)

Date :   22 Sep 09 (Deposition) - 16 Jun 10 (Release) - 21 Jul 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.28

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Kbp- Binding Domain Five-Stranded Anti-Parallel -Sheet And An -Helix Crossing This Sheet, Structural Genomics, Israel Structural Proteomics Center, Ispc, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Unger, O. Dym, S. Albeck, Y. Jacobovitch, R. Bernehim, D. Marom, O. Pisanty, A. Breiman
Crystal Structure Of The Three Fk506 Binding Protein Domain Of Wheat Fkbp73: Evidence For A Unique Wfk73_2 Domain
J. Struct. Funct. Genom. V. 11 113 2010
PubMed-ID: 20306145 | Reference-DOI: 10.1007/S10969-010-9085-8

Molecule 1 - FK506-BINDING PROTEIN (FKBP) FROM WHEAT
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	WHEAT
	Organism Scientific	:	TRITICUM AESTIVUM
	Organism Taxid	:	4565

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	UNK	2	Mod. Amino Acid

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	UNK	-1	Mod. Amino Acid

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	UNK	-1	Mod. Amino Acid

(no "Site" information available for 3JYM)

(no "SS Bond" information available for 3JYM)

Asymmetric Unit

No.	Residues
1	Phe A:87	-	Lys A:88
2	Gly A:244	-	Glu A:245
3	Glu B:245	-	Gly B:246

(no "SAP(SNP)/Variant" information available for 3JYM)

Asymmetric Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FKBP_PPIASE	PS50059	FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.	FKB70_WHEAT	60-148 176-265 293-384	6	A:60-148 B:60-148 A:176-265 B:176-265 A:293-384 B:293-384

Biological Unit 1 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FKBP_PPIASE	PS50059	FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.	FKB70_WHEAT	60-148 176-265 293-384	3	A:60-148 - A:176-265 - A:293-384 -

Biological Unit 2 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FKBP_PPIASE	PS50059	FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.	FKB70_WHEAT	60-148 176-265 293-384	3	- B:60-148 - B:176-265 - B:293-384

(no "Exon" information available for 3JYM)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:301
 aligned with FKB70_WHEAT | Q43207 from UniProtKB/Swiss-Prot  Length:559

    Alignment length:354
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382    
          FKB70_WHEAT    33 GEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD 386
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee.----------------........eeeee..------------------..ee........hhhhhhhhh....eeeee..-------------------.eeeeeeeeee.eee......eeeeeee............eeeeeeeeee....eeeeeeeeeee.hhh..hhhhhhhhh......eeeeee.hhhh....................eeeeeeeeeee.eeee.....eeeeeee............eeeeeeeee.....eeeee.......eeee......hhhhhhhhhh.....eeeeeehhhhh.....ee...ee.....eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------FKBP_PPIASE  PDB: A:60-148 UniProt: 60-148                                               ---------------------------FKBP_PPIASE  PDB: A:176-265 UniProt: 176-265                                              ---------------------------FKBP_PPIASE  PDB: A:293-384 UniProt: 293-384                                                -- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3jym A  33 GEENE----------------WDTPEVGDEVEVHYT------------------FKFKLGQGQVIKGWDQGIKTMKKGENALFTIP-------------------LQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKExEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD 386
                                |    -         - |      62     |   -         -    |   92       102       112     |   -         -     | 142       152       162       172       182       192       202       212       222       232       242       252       262       272       282 |     292       302       312       322       332       342       352       362       372       382    
                               37               54            68                 87                            118                 138                                                                                                                                               284-UNK

Chain B from PDB  Type:PROTEIN  Length:308
 aligned with FKB70_WHEAT | Q43207 from UniProtKB/Swiss-Prot  Length:559

    Alignment length:354
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382    
          FKB70_WHEAT    33 GEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD 386
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FKBP_C-3jymB01 B:286-381                                                                        ----- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FKBP_C-3jymB02 B:286-381                                                                        ----- Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FKBP_C-3jymB03 B:286-381                                                                        ----- Pfam domains (3)
           Pfam domains (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FKBP_C-3jymB04 B:286-381                                                                        ----- Pfam domains (4)
           Pfam domains (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FKBP_C-3jymB05 B:286-381                                                                        ----- Pfam domains (5)
           Pfam domains (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FKBP_C-3jymB06 B:286-381                                                                        ----- Pfam domains (6)
         Sec.struct. author ....ee----------------.......eeeeeee.-----------------..ee......hhhhhhhhh......eeeeee.-------------......eeeeeeeeeee.eee......eeeeeee............eeeeeeeeee....eeeeeeeeeee.hhh..hhhhhhhhh......eeeeee.hhhh....................eeeeeeeeeee.eeee.....eeeeeee............eeeeeeeeee....eeeee.......eeee......hhhhhhhhh......eeeeeehhhhh.....ee...ee.....eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------FKBP_PPIASE  PDB: B:60-148 UniProt: 60-148                                               ---------------------------FKBP_PPIASE  PDB: B:176-265 UniProt: 176-265                                              ---------------------------FKBP_PPIASE  PDB: B:293-384 UniProt: 293-384                                                -- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3jym B  33 GEENEI----------------DTPEVGDEVEVHYTG-----------------FKFKLGQGQVIKGWDQGIKTMKKGENALFTIP-------------IPANATLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKExEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD 386
                                 |   -         -  |     62      |  -         -    |   92       102       112     |   -       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282 |     292       302       312       322       332       342       352       362       372       382    
                                38               55            69                87                            118           132                                                                                                                                                     284-UNK

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3JYM)

(no "CATH Domain" information available for 3JYM)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: FKBP_C] (58)

Family: FKBP_C (58)

Triticum aestivum (Wheat) (2)

1a	FKBP_C-3jymB01	B:286-381
1b	FKBP_C-3jymB02	B:286-381
1c	FKBP_C-3jymB03	B:286-381
1d	FKBP_C-3jymB04	B:286-381
1e	FKBP_C-3jymB05	B:286-381
1f	FKBP_C-3jymB06	B:286-381

Asymmetric Unit(hide GO term definitions)

Chain A,B (FKB70_WHEAT | Q43207)

molecular function
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0003755	peptidyl-prolyl cis-trans isomerase activity	Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
biological process
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0000413	protein peptidyl-prolyl isomerization	The modification of a protein by cis-trans isomerization of a proline residue.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		UNK	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 3jym)

	Cis Peptide Bonds
		Glu B:245 - Gly B:246	[ RasMol ]
		Gly A:244 - Glu A:245	[ RasMol ]
		Phe A:87 - Lys A:88	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3jym
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FKB70_WHEAT \| Q43207
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FKB70_WHEAT \| Q43207
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	FKB70_WHEAT \| Q43207	:	3jxv

(no "Related Entries Specified in the PDB File" available for 3JYM)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 6)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File