3IK7 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN GLUTATHIONE TRANSFERASE A4-4 WITH GSDHN

Authors :   L. M. Balogh, I. Le Trong, W. M. Atkins, R. E. Stenkamp

Date :   05 Aug 09 (Deposition) - 23 Jun 10 (Release) - 23 Jun 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.97

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Human Gst A4-4, Enzyme, Transferase, Cytoplasm, Polymorphism (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. M. Balogh, I. Le Trong, K. A. Kripps, L. M. Shireman, R. E. Stenkamp, W. Zhang, B. Mannervik, W. M. Atkins
Substrate Specificity Combined With Stereopromiscuity In Glutathione Transferase A4-4-Dependent Metabolism Of 4-Hydroxynonenal.
Biochemistry V. 49 1541 2010
PubMed-ID: 20085333 | Reference-DOI: 10.1021/BI902038U

Molecule 1 - GLUTATHIONE S-TRANSFERASE A4
	Chains	:	A, B, C, D
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	GSTA4
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GLUTATHIONE S-TRANSFERASE A4-4, GST CLASS-ALPHA MEMBER 4

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 5)

No.	Name	Count	Type	Full Name
1	BOB	4	Ligand/Ion	(S)-2-AMINO-5-((R)-1-(CARBOXYMETHYLAMINO)-3-((3S,4R)-1,4-DIHYDROXYNONAN-3-YLTHIO)-1-OXOPROPAN-2-YLAMINO)-5-OXOPENTANOIC ACID
2	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	BOB	2	Ligand/Ion	(S)-2-AMINO-5-((R)-1-(CARBOXYMETHYLAMINO)-3-((3S,4R)-1,4-DIHYDROXYNONAN-3-YLTHIO)-1-OXOPROPAN-2-YLAMINO)-5-OXOPENTANOIC ACID
2	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 3)

No.	Name	Count	Type	Full Name
1	BOB	2	Ligand/Ion	(S)-2-AMINO-5-((R)-1-(CARBOXYMETHYLAMINO)-3-((3S,4R)-1,4-DIHYDROXYNONAN-3-YLTHIO)-1-OXOPROPAN-2-YLAMINO)-5-OXOPENTANOIC ACID
2	SO4	1	Ligand/Ion	SULFATE ION

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:9 , ARG A:15 , GLN A:54 , VAL A:55 , PRO A:56 , GLN A:67 , THR A:68 , PHE A:111 , TYR A:212 , PHE A:220 , HOH A:6007 , HOH A:6150 , HOH A:6210 , ASP B:101 , ARG B:131	BINDING SITE FOR RESIDUE BOB A 501
2	AC2	SOFTWARE	ASP A:101 , ARG A:131 , TYR B:9 , GLY B:14 , ARG B:15 , GLN B:45 , GLN B:54 , VAL B:55 , GLN B:67 , THR B:68 , PHE B:111 , TYR B:212 , PHE B:220 , HOH B:6008 , HOH B:6125 , HOH B:6161	BINDING SITE FOR RESIDUE BOB B 502
3	AC3	SOFTWARE	TYR C:9 , GLY C:14 , GLN C:45 , GLN C:54 , VAL C:55 , GLN C:67 , THR C:68 , TYR C:212 , PHE C:220 , HOH C:6131 , ASP D:101 , ARG D:131	BINDING SITE FOR RESIDUE BOB C 503
4	AC4	SOFTWARE	ASP C:101 , ARG C:131 , TYR D:9 , GLY D:14 , ARG D:15 , GLN D:54 , VAL D:55 , GLN D:67 , THR D:68 , MET D:108 , TYR D:212 , TYR D:217 , PHE D:220 , HOH D:6104	BINDING SITE FOR RESIDUE BOB D 504
5	AC5	SOFTWARE	LYS C:43 , THR D:37 , LYS D:38 , GLU D:39 , ASN D:218 , ARG D:221	BINDING SITE FOR RESIDUE SO4 D 551

(no "SS Bond" information available for 3IK7)

Asymmetric Unit

No.	Residues
1	Val A:55	-	Pro A:56
2	Val B:55	-	Pro B:56
3	Val C:55	-	Pro C:56
4	Val D:55	-	Pro D:56

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_022210	L	100	P	GSTA4_HUMAN	Polymorphism	45551133	A/B/C/D	L	100	P
2	UniProt	VAR_022211	T	163	A	GSTA4_HUMAN	Polymorphism	4147617	A/B/C/D	T	163	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_022210	L	100	P	GSTA4_HUMAN	Polymorphism	45551133	A/B	L	100	P
2	UniProt	VAR_022211	T	163	A	GSTA4_HUMAN	Polymorphism	4147617	A/B	T	163	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_022210	L	100	P	GSTA4_HUMAN	Polymorphism	45551133	C/D	L	100	P
2	UniProt	VAR_022211	T	163	A	GSTA4_HUMAN	Polymorphism	4147617	C/D	T	163	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTA4_HUMAN	3-83	4	A:3-83 B:3-83 C:3-83 D:3-83
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTA4_HUMAN	85-208	4	A:85-208 B:85-208 C:85-208 D:85-208

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTA4_HUMAN	3-83	2	A:3-83 B:3-83 - -
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTA4_HUMAN	85-208	2	A:85-208 B:85-208 - -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTA4_HUMAN	3-83	2	- - C:3-83 D:3-83
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTA4_HUMAN	85-208	2	- - C:85-208 D:85-208

Asymmetric Unit (6, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000370963	1a	ENSE00001454017	chr6:52860176-52860047	130	GSTA4_HUMAN	-	0	0	-	-
1.3b	ENST00000370963	3b	ENSE00002148969	chr6:52859059-52858955	105	GSTA4_HUMAN	1-29	29	4	A:2-29 B:3-29 C:3-29 D:2-29	28 27 27 28
1.4b	ENST00000370963	4b	ENSE00002179898	chr6:52852206-52852155	52	GSTA4_HUMAN	30-47	18	4	A:30-47 B:30-47 C:30-47 D:30-47	18 18 18 18
1.5	ENST00000370963	5	ENSE00002153494	chr6:52850381-52850249	133	GSTA4_HUMAN	47-91	45	4	A:47-91 B:47-91 C:47-91 D:47-91	45 45 45 45
1.6	ENST00000370963	6	ENSE00002191487	chr6:52849403-52849262	142	GSTA4_HUMAN	91-138	48	4	A:91-138 B:91-138 C:91-138 D:91-138	48 48 48 48
1.7	ENST00000370963	7	ENSE00002156856	chr6:52847503-52847372	132	GSTA4_HUMAN	139-182	44	4	A:139-182 B:139-182 C:139-182 D:139-182	44 44 44 44
1.8c	ENST00000370963	8c	ENSE00002153108	chr6:52843390-52842751	640	GSTA4_HUMAN	183-222	40	4	A:183-222 B:183-221 C:183-220 D:183-221	40 39 38 39

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:221
 aligned with GSTA4_HUMAN | O15217 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221 
          GSTA4_HUMAN     2 AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP 222
               SCOP domains d3ik7a1 A:2-80 Class alpha GST                                                 d3ik7a2 A:81-222 Class alpha GST                                                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee......hhhhhhhhhhh....eeee..hhhhhhhhhhh.........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------P--------------------------------------------------------------A----------------------------------------------------------- SAPs(SNPs)
                    PROSITE -GST_NTER  PDB: A:3-83 UniProt: 3-83                                              -GST_CTER  PDB: A:85-208 UniProt: 85-208                                                                                     -------------- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: A:2-29      Exon 1.4b         -------------------------------------------Exon 1.6  PDB: A:91-138 UniProt: 91-138         Exon 1.7  PDB: A:139-182 UniProt: 139-182   Exon 1.8c  PDB: A:183-222                Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.5  PDB: A:47-91 UniProt: 47-91        ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3ik7 A   2 AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP 222
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain B from PDB  Type:PROTEIN  Length:219
 aligned with GSTA4_HUMAN | O15217 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:219
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212         
          GSTA4_HUMAN     3 ARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFR 221
               SCOP domains d3ik7b1 B:3-80 Class alpha GST                                                d3ik7b2 B:81-221 Class alpha GST                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee......hhhhhhhhhhh....eeee..hhhhhhhhhhh.........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------P--------------------------------------------------------------A---------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: B:3-83 UniProt: 3-83                                              -GST_CTER  PDB: B:85-208 UniProt: 85-208                                                                                     ------------- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: B:3-29     Exon 1.4b         -------------------------------------------Exon 1.6  PDB: B:91-138 UniProt: 91-138         Exon 1.7  PDB: B:139-182 UniProt: 139-182   Exon 1.8c  PDB: B:183-221 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.5  PDB: B:47-91 UniProt: 47-91        ---------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3ik7 B   3 ARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFR 221
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212

Chain C from PDB  Type:PROTEIN  Length:218
 aligned with GSTA4_HUMAN | O15217 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:218
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212        
          GSTA4_HUMAN     3 ARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIF 220
               SCOP domains d3ik7c1 C:3-80 Class alpha GST                                                d3ik7c2 C:81-220 Class alpha GST                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....hhhhhhhhhhh....eeeee.hhhhhhhhhhh.........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------P--------------------------------------------------------------A--------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: C:3-83 UniProt: 3-83                                              -GST_CTER  PDB: C:85-208 UniProt: 85-208                                                                                     ------------ PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: C:3-29     Exon 1.4b         -------------------------------------------Exon 1.6  PDB: C:91-138 UniProt: 91-138         Exon 1.7  PDB: C:139-182 UniProt: 139-182   Exon 1.8c  PDB: C:183-220 [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.5  PDB: C:47-91 UniProt: 47-91        --------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3ik7 C   3 ARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIF 220
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212

Chain D from PDB  Type:PROTEIN  Length:220
 aligned with GSTA4_HUMAN | O15217 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:220
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
          GSTA4_HUMAN     2 AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFR 221
               SCOP domains d3ik7d1 D:2-80 Class alpha GST                                                 d3ik7d2 D:81-221 Class alpha GST                                                                                                              SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.....hhhhhhhhhhh....eeeee.hhhhhhhhhhh.........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhh.hhhhhhhhh.........hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------P--------------------------------------------------------------A---------------------------------------------------------- SAPs(SNPs)
                    PROSITE -GST_NTER  PDB: D:3-83 UniProt: 3-83                                              -GST_CTER  PDB: D:85-208 UniProt: 85-208                                                                                     ------------- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: D:2-29      Exon 1.4b         -------------------------------------------Exon 1.6  PDB: D:91-138 UniProt: 91-138         Exon 1.7  PDB: D:139-182 UniProt: 139-182   Exon 1.8c  PDB: D:183-221 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.5  PDB: D:47-91 UniProt: 47-91        ---------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3ik7 D   2 AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFR 221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: Glutathione S-transferase (GST), C-terminal domain (263)

Protein domain: Class alpha GST (53)

Human (Homo sapiens), (a1-1) [TaxId: 9606] (27)

1a	d3ik7a2	A:81-222
1b	d3ik7b2	B:81-221
1c	d3ik7c2	C:81-220
1d	d3ik7d2	D:81-221

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: Glutathione S-transferase (GST), N-terminal domain (216)

Protein domain: Class alpha GST (53)

Human (Homo sapiens), (a1-1) [TaxId: 9606] (27)

2a	d3ik7a1	A:2-80
2b	d3ik7b1	B:3-80
2c	d3ik7c1	C:3-80
2d	d3ik7d1	D:2-80

(no "CATH Domain" information available for 3IK7)

(no "Pfam Domain" information available for 3IK7)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (GSTA4_HUMAN | O15217)

molecular function
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BOB	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Val A:55 - Pro A:56	[ RasMol ]
		Val B:55 - Pro B:56	[ RasMol ]
		Val C:55 - Pro C:56	[ RasMol ]
		Val D:55 - Pro D:56	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ik7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GSTA4_HUMAN \| O15217
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GSTA4_HUMAN \| O15217
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GSTA4_HUMAN \| O15217	:	1gul 1gum

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (2, 8)

Exons (6, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File