Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  SAM DOMAIN OF HUMAN EPHRIN TYPE-A RECEPTOR 7 (EPHA7)
 
Authors :  J. R. Walker, L. Yermekbayeva, C. Butler-Cole, C. Bountra, J. Weigelt, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, S. Dhe-Paganon, Structural Genomics Consortium (Sgc)
Date :  29 Apr 09  (Deposition) - 26 May 09  (Release) - 09 Jun 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Sam Domain, Kinase, Structural Genomics, Structural Genomics Consortium, Sgc, Alternative Splicing, Atp-Binding, Glycoprotein, Membrane, Nucleotide-Binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-Protein Kinase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. R. Walker, L. Yermekbayeva, C. Butler-Cole, C. Bountra, J. Weigelt, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, S. Dhe-Paganon
Sam Domain Of Human Ephrin Type-A Receptor 7 (Epha7)
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EPHRIN TYPE-A RECEPTOR 7
    ChainsA, B
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28-MHL
    Expression System StrainBL21(DE3)V2R
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentSAM DOMAIN, RESIDUES 919-990
    GeneEHK3, EPHA7, HEK11
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymTYROSINE-PROTEIN KINASE RECEPTOR EHK-3, EPH HOMOLOGY KINASE 3, RECEPTOR PROTEIN-TYROSINE KINASE HEK11

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3H8M)

(-) Sites  (0, 0)

(no "Site" information available for 3H8M)

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:926 -B:926

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3H8M)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3H8M)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_DOMAINPS50105 SAM domain profile.EPHA7_HUMAN923-987
 
  2A:923-987
B:923-987
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_DOMAINPS50105 SAM domain profile.EPHA7_HUMAN923-987
 
  1A:923-987
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_DOMAINPS50105 SAM domain profile.EPHA7_HUMAN923-987
 
  1-
B:923-987

(-) Exons   (3, 5)

Asymmetric Unit (3, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000003693031cENSE00001941413chr6:94129244-94128963282EPHA7_HUMAN1-33330--
1.2ENST000003693032ENSE00000974737chr6:94124485-9412442165EPHA7_HUMAN33-54220--
1.3aENST000003693033aENSE00000918734chr6:94120888-94120219670EPHA7_HUMAN55-2782240--
1.4ENST000003693034ENSE00000974738chr6:94068129-94067974156EPHA7_HUMAN278-330530--
1.5ENST000003693035ENSE00000974739chr6:94066770-94066435336EPHA7_HUMAN330-4421130--
1.6ENST000003693036ENSE00001309196chr6:93982140-93982016125EPHA7_HUMAN442-483420--
1.7bENST000003693037bENSE00000974741chr6:93979378-93979195184EPHA7_HUMAN484-545620--
1.8ENST000003693038ENSE00001084117chr6:93974420-93974312109EPHA7_HUMAN545-581370--
1.9ENST000003693039ENSE00000974743chr6:93973633-9397357856EPHA7_HUMAN581-600200--
1.10ENST0000036930310ENSE00000974744chr6:93969197-93969072126EPHA7_HUMAN600-642430--
1.11ENST0000036930311ENSE00000974745chr6:93968002-93967817186EPHA7_HUMAN642-704630--
1.12ENST0000036930312ENSE00000974746chr6:93967241-9396718062EPHA7_HUMAN704-724210--
1.13ENST0000036930313ENSE00002150360chr6:93965755-93965546210EPHA7_HUMAN725-794700--
1.14ENST0000036930314ENSE00002154876chr6:93964514-93964365150EPHA7_HUMAN795-844500--
1.15ENST0000036930315ENSE00000974749chr6:93956703-93956510194EPHA7_HUMAN845-909651-
B:912-913
-
2
1.16ENST0000036930316ENSE00000974750chr6:93955171-93955016156EPHA7_HUMAN909-961532A:919-961
B:914-961
43
48
1.17ENST0000036930317ENSE00001449448chr6:93953258-939497383521EPHA7_HUMAN961-998382A:961-989
B:961-990
29
30

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:71
 aligned with EPHA7_HUMAN | Q15375 from UniProtKB/Swiss-Prot  Length:998

    Alignment length:71
                                   928       938       948       958       968       978       988 
          EPHA7_HUMAN   919 TPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQML 989
               SCOP domains d3h8ma_ A: automated matches                                            SCOP domains
               CATH domains 3h8mA00 A:919-989 Transcription Factor, Ets-1                           CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhh...hhhhhhh.hhhhhhhh...hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SAM_DOMAIN  PDB: A:923-987 UniProt: 923-987                      -- PROSITE
           Transcript 1 (1) ------------------------------------------Exon 1.17  PDB: A:961-989     Transcript 1 (1)
           Transcript 1 (2) Exon 1.16  PDB: A:919-961 UniProt: 909-961 ---------------------------- Transcript 1 (2)
                 3h8m A 919 TPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQML 989
                                   928       938       948       958       968       978       988 

Chain B from PDB  Type:PROTEIN  Length:79
 aligned with EPHA7_HUMAN | Q15375 from UniProtKB/Swiss-Prot  Length:998

    Alignment length:107
                                   893       903       913       923       933       943       953       963       973       983       
          EPHA7_HUMAN   884 EQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLH 990
               SCOP domains d3                            h8mb_ B: automated matches                                                    SCOP domains
               CATH domains 3h                            8mB00 B:912-990 Transcription Factor, Ets-1                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..----------------------------.......hhhhh.hhhhhhhhh.hhhhhhhhhhh...hhhhhhh.hhhhhhh....hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------SAM_DOMAIN  PDB: B:923-987 UniProt: 923-987                      --- PROSITE
           Transcript 1 (1) Exon 1.15  PDB: B:912-913 ---------------------------------------------------Exon 1.17  PDB: B:961-990      Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.16  PDB: B:914-961 UniProt: 909-961           ----------------------------- Transcript 1 (2)
                 3h8m B 912 EN----------------------------LYFQGTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLH 990
                             |       -         -         -|      923       933       943       953       963       973       983       
                           913                          914                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3H8M)

(-) Gene Ontology  (44, 44)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (EPHA7_HUMAN | Q15375)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005004    GPI-linked ephrin receptor activity    Combining with a GPI-anchored ephrin to initiate a change in cell activity.
    GO:0008046    axon guidance receptor activity    Combining with an extracellular messenger and transmitting the signal from one side of the membrane to the other to results in a change in cellular activity involved in axon guidance.
    GO:0045499    chemorepellent activity    Providing the environmental signal that initiates the directed movement of a motile cell or organism towards a lower concentration of that signal.
    GO:0005003    ephrin receptor activity    Combining with an ephrin to initiate a change in cell activity.
    GO:0046875    ephrin receptor binding    Interacting selectively and non-covalently with an ephrin receptor.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:0048755    branching morphogenesis of a nerve    The process in which the anatomical structures of branches in a nerve are generated and organized. This term refers to an anatomical structure (nerve) not a cell (neuron).
    GO:0048013    ephrin receptor signaling pathway    The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0050919    negative chemotaxis    The directed movement of a motile cell or organism towards a lower concentration of a chemical.
    GO:0048671    negative regulation of collateral sprouting    Any process that stops, prevents, or reduces the frequency, rate or extent of collateral sprouting.
    GO:0051964    negative regulation of synapse assembly    Any process that stops, prevents, or reduces the frequency, rate or extent of synapse assembly, the aggregation, arrangement and bonding together of a set of components to form a synapse.
    GO:0072178    nephric duct morphogenesis    The process in which the anatomical structures of the nephric duct are generated and organized. A nephric duct is a tube that drains a primitive kidney.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0043525    positive regulation of neuron apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0070372    regulation of ERK1 and ERK2 cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0022407    regulation of cell-cell adhesion    Any process that modulates the frequency, rate or extent of attachment of a cell to another cell.
    GO:0043281    regulation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that modulates the activity of a cysteine-type endopeptidase involved in apoptosis.
    GO:0050730    regulation of peptidyl-tyrosine phosphorylation    Any process that modulates the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0031952    regulation of protein autophosphorylation    Any process that modulates the frequency, rate or extent of addition of the phosphorylation by a protein of one or more of its own residues.
    GO:0031290    retinal ganglion cell axon guidance    The process in which the migration of an axon growth cone of a retinal ganglion cell (RGC) is directed to its target in the brain in response to a combination of attractive and repulsive cues.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031594    neuromuscular junction    The junction between the axon of a motor neuron and a muscle fiber. In response to the arrival of action potentials, the presynaptic button releases molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane of the muscle fiber, leading to a change in post-synaptic potential.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045211    postsynaptic membrane    A specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters cross the synaptic cleft and transmit the signal to the postsynaptic membrane.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3h8m)
 
  Sites
(no "Sites" information available for 3h8m)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3h8m)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3h8m
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EPHA7_HUMAN | Q15375
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  EPHA7_HUMAN | Q15375
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EPHA7_HUMAN | Q153752rei 3dko 3nru

(-) Related Entries Specified in the PDB File

2rei KINASE DOMAIN OF HUMAN EPHRIN TYPE-A RECEPTOR 7 (EPHA7)
3dko COMPLEX BETWEEN THE KINASE DOMAIN OF HUMAN EPHRIN TYPE-A RECEPTOR 7 (EPHA7) AND INHIBITOR ALW-II-49-7