Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE SINGLE-CHAIN FV (SCFV) FRAGMENT OF AN ANTI-ERBB2 ANTIBODY CHA21 IN COMPLEX WITH RESIDUES 1-192 OF ERBB2 EXTRACELLULAR DOMAIN
 
Authors :  H. Zhou, Y. Liu, L. Niu, J. Zhu, M. Teng
Date :  16 Apr 09  (Deposition) - 28 Apr 10  (Release) - 28 Sep 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.45
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Immunoglobulin, Beta-Helix, Protein-Protein Complex, Atp-Binding, Disulfide Bond, Kinase, Nucleotide-Binding, Receptor, Transferase, Transmembrane, Tyrosine-Protein Kinase, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Zhou, Z. Zha, Y. Liu, H. Zhang, J. Zhu, S. Hu, G. Shen, L. Cheng, L. Niu, M. I. Greene, M. Teng, J. Liu
Structural Insights Into The Down-Regulation Of Overexpressed P185Her2/Neu Protein Of Transformed Cells By The Antibody Cha21.
J. Biol. Chem. V. 286 31676 2011
PubMed-ID: 21680730  |  Reference-DOI: 10.1074/JBC.M111.235184

(-) Compounds

Molecule 1 - RECEPTOR TYROSINE-PROTEIN KINASE ERBB-2
    ChainsA, B
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-4T-1
    Expression System StrainORIGAMI B
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentEXTRACELLULAR DOMAIN, UNP RESIDUES 23-214
    GeneERBB2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymP185ERBB2, C-ERBB-2, NEU PROTO-ONCOGENE, TYROSINE KINASE- TYPE CELL SURFACE RECEPTOR HER2, MLN 19
 
Molecule 2 - ANTI-ERBB2 ANTIBODY CHA21
    ChainsC, D
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System Cell LineCHO CELLS
    Expression System OrganOVARY
    Expression System PlasmidPEE14
    Expression System Taxid10029
    Expression System Vector TypePLASMID
    FragmentTHE SINGLE-CHAIN FV (SCFV) FRAGMENT
    GeneSCFV OF MURINE ANTIBODY A21
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    StrainBALB/C

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A C 
Biological Unit 2 (1x) B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3H3B)

(-) Sites  (0, 0)

(no "Site" information available for 3H3B)

(-) SS Bonds  (12, 12)

Asymmetric Unit
No.Residues
1A:4 -A:31
2A:140 -A:170
3A:173 -A:182
4A:177 -A:190
5B:4 -B:31
6B:140 -B:170
7B:173 -B:182
8B:177 -B:190
9C:23 -C:94
10C:156 -C:230
11D:23 -D:94
12D:156 -D:230

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Thr C:7 -Pro C:8
2Tyr C:100 -Pro C:101
3Thr D:7 -Pro D:8
4Tyr D:100 -Pro D:101

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3H3B)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3H3B)

(-) Exons   (5, 10)

Asymmetric Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.4ENST000002695714ENSE00001234770chr17:37856254-37856564311ERBB2_HUMAN1-25252A:0-3
B:0-3
4
4
1.5ENST000002695715ENSE00001673952chr17:37863243-37863394152ERBB2_HUMAN25-75512A:3-53
B:3-53
51
51
1.6ENST000002695716ENSE00000950603chr17:37864574-37864787214ERBB2_HUMAN76-147722A:54-125
B:54-125
72
72
1.7ENST000002695717ENSE00001200960chr17:37865571-37865705135ERBB2_HUMAN147-192462A:125-170
B:125-170
46
46
1.8ENST000002695718ENSE00001200956chr17:37866066-3786613469ERBB2_HUMAN192-215242A:170-192
B:170-191 (gaps)
23
22
1.9ENST000002695719ENSE00001200949chr17:37866339-37866454116ERBB2_HUMAN215-253390--
1.10ENST0000026957110ENSE00000950607chr17:37866593-37866734142ERBB2_HUMAN254-301480--
1.11ENST0000026957111ENSE00001200943chr17:37868181-37868300120ERBB2_HUMAN301-341410--
1.12ENST0000026957112ENSE00001200937chr17:37868575-37868701127ERBB2_HUMAN341-383430--
1.13ENST0000026957113ENSE00001121108chr17:37871539-3787161274ERBB2_HUMAN383-408260--
1.14ENST0000026957114ENSE00001121103chr17:37871699-3787178991ERBB2_HUMAN408-438310--
1.15ENST0000026957115ENSE00001121098chr17:37871993-37872192200ERBB2_HUMAN438-505680--
1.16ENST0000026957116ENSE00001121093chr17:37872554-37872686133ERBB2_HUMAN505-549450--
1.17ENST0000026957117ENSE00001121088chr17:37872768-3787285891ERBB2_HUMAN549-579310--
1.18ENST0000026957118ENSE00000950615chr17:37873573-37873733161ERBB2_HUMAN580-633540--
1.19ENST0000026957119ENSE00001121079chr17:37876040-3787608748ERBB2_HUMAN633-649170--
1.20ENST0000026957120ENSE00001121070chr17:37879572-37879710139ERBB2_HUMAN649-695470--
1.21ENST0000026957121ENSE00000950618chr17:37879791-37879913123ERBB2_HUMAN696-736410--
1.22ENST0000026957122ENSE00000950619chr17:37880165-3788026399ERBB2_HUMAN737-769330--
1.23ENST0000026957123ENSE00000950620chr17:37880979-37881164186ERBB2_HUMAN770-831620--
1.24ENST0000026957124ENSE00000950621chr17:37881302-37881457156ERBB2_HUMAN832-883520--
1.25ENST0000026957125ENSE00001717073chr17:37881580-3788165576ERBB2_HUMAN884-909260--
1.26ENST0000026957126ENSE00000950623chr17:37881960-37882106147ERBB2_HUMAN909-958500--
1.27ENST0000026957127ENSE00000950624chr17:37882815-3788291298ERBB2_HUMAN958-990330--
1.28ENST0000026957128ENSE00000950625chr17:37883068-37883256189ERBB2_HUMAN991-1053630--
1.29ENST0000026957129ENSE00000950626chr17:37883548-37883800253ERBB2_HUMAN1054-1138850--
1.30ENST0000026957130ENSE00001384235chr17:37883942-37884915974ERBB2_HUMAN1138-12551180--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:193
 aligned with ERBB2_HUMAN | P04626 from UniProtKB/Swiss-Prot  Length:1255

    Alignment length:193
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211   
          ERBB2_HUMAN    22 STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQS 214
               SCOP domains d3h3ba1 A:0-165 automated matches                                                                                                                                     d3h3ba2 A:166-192           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..........hhhhhhhhhhhhhh...eee..eeee.......hhhhh...ee...eeee.....eee.....ee....hhhh.eeeeee.....................eee.....ee...eeeee...........hhhhhh........eee.............................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.4 --------------------------------------------------Exon 1.6  PDB: A:54-125 UniProt: 76-147                                 --------------------------------------------Exon 1.8  PDB: A:170-19 Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.5  PDB: A:3-53 UniProt: 25-75               -----------------------------------------------------------------------Exon 1.7  PDB: A:125-170 UniProt: 147-192     ---------------------- Transcript 1 (2)
                 3h3b A   0 STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQS 192
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189   

Chain B from PDB  Type:PROTEIN  Length:189
 aligned with ERBB2_HUMAN | P04626 from UniProtKB/Swiss-Prot  Length:1255

    Alignment length:192
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211  
          ERBB2_HUMAN    22 STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQ 213
               SCOP domains d3h3bb1 B:0-165 automated matches                                                                                                                                     d3h3bb2 B:16   6-191       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eee..........hhhhhhhhhhhhhh...eee..eeee.......hhhhh...ee...eeee.....eee.....ee.........eeeeee.....................eee.....ee...eeeee......hhhhhhhhhhh........eee...............---.....hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.4 --------------------------------------------------Exon 1.6  PDB: B:54-125 UniProt: 76-147                                 --------------------------------------------Exon 1.8 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.5  PDB: B:3-53 UniProt: 25-75               -----------------------------------------------------------------------Exon 1.7  PDB: B:125-170 UniProt: 147-192     --------------------- Transcript 1 (2)
                 3h3b B   0 STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMC---RCWGESSEDCQ 191
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       | - |     189  
                                                                                                                                                                                                           177 181          

Chain C from PDB  Type:PROTEIN  Length:234
                                                                                                                                                                                                                                                                          
               SCOP domains d3h3bc1 C:-2-112 automated matches                                                                                 -d3h3bc2 C:136-253 automated matches                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------3h3bC02 C:138-244 Immunoglobulins                                                                          --------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeee..eee......eeeeeee....ee....ee.eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhh.eeeeee......ee...eeee...eeee...eee.....eeeeeeee..hhhh.eeeeeee......eeeeeee.....eee.hhhh..eeeeee....eeeeee...hhhhheeeeeeee.hhhhh.eeee...eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3h3b C  -2 QPADIVLTQTPSSLPVSVGEKVTMTCKSSQTLLYSNNQKNYLAWYQQKPGQSPKLLISWAFTRKSGVPDRFTGSGSGTDFTLTIGSVKAEDLAVYYCQQYSNYPWTFGGGTRLEIEVQLQQSGPEVVKTGASVKISCKASGYSFTGYFINWVKKNSGKSPEWIGHISSSYATSTYNQKFKNKAAFTVDTSSSTAFMQLNSLTSEDSAVYYCVRSGNYEEYAMDYWGQGTSVTVS 253
                                     7        17        27        37        47        57        67        77        87        97       107    || 139       149       159       169       179       189       199       209       219       229       239       249    
                                                                                                                                            112|                                                                                                                      
                                                                                                                                             135                                                                                                                      

Chain D from PDB  Type:PROTEIN  Length:236
                                                                                                                                                                                                                                                                            
               SCOP domains d3h3bd1 D:-2-113 automated matches                                                                                  --d3h3bd2 D:136-253 automated matches                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------3h3bD02 D:138-244 Immunoglobulins                                                                          --------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee..eeee.....eeeeeee....ee....ee.eeeeee......eeeee...ee.......eeeeee..eeeeee.........eeeeee......ee...eeeee....eeee...eeee....eeeeeeee..hhhh.eeeeeee......eeeeeee.....eee.......eeeeee....eeeeee...hhhhheeeeeeee.hhhhh.eeee...eeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3h3b D  -2 QPADIVLTQTPSSLPVSVGEKVTMTCKSSQTLLYSNNQKNYLAWYQQKPGQSPKLLISWAFTRKSGVPDRFTGSGSGTDFTLTIGSVKAEDLAVYYCQQYSNYPWTFGGGTRLEIKSEVQLQQSGPEVVKTGASVKISCKASGYSFTGYFINWVKKNSGKSPEWIGHISSSYATSTYNQKFKNKAAFTVDTSSSTAFMQLNSLTSEDSAVYYCVRSGNYEEYAMDYWGQGTSVTVS 253
                                     7        17        27        37        47        57        67        77        87        97       107     ||137       147       157       167       177       187       197       207       217       227       237       247      
                                                                                                                                             113|                                                                                                                       
                                                                                                                                              134                                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 8)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3H3B)

(-) Gene Ontology  (73, 73)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (ERBB2_HUMAN | P04626)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0043125    ErbB-3 class receptor binding    Interacting selectively and non-covalently with the protein-tyrosine kinase receptor ErbB-3/HER3.
    GO:0001042    RNA polymerase I core binding    Interacting selectively and non-covalently with RNA polymerase I core enzyme, a multisubunit eukaryotic nuclear RNA polymerase typically composed of seventeen subunits.
    GO:0005088    Ras guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0019838    growth factor binding    Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0046934    phosphatidylinositol-4,5-bisphosphate 3-kinase activity    Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019903    protein phosphatase binding    Interacting selectively and non-covalently with any protein phosphatase.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0004716    signal transducer, downstream of receptor, with protein tyrosine kinase activity    Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0071363    cellular response to growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a growth factor stimulus.
    GO:0007167    enzyme linked receptor protein signaling pathway    Any series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell, where the receptor possesses catalytic activity or is closely associated with an enzyme such as a protein kinase, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0008045    motor neuron axon guidance    The process in which the migration of an axon growth cone of a motor neuron is directed to a specific target site in response to a combination of attractive and repulsive cues.
    GO:0042552    myelination    The process in which myelin sheaths are formed and maintained around neurons. Oligodendrocytes in the brain and spinal cord and Schwann cells in the peripheral nervous system wrap axons with compact layers of their plasma membrane. Adjacent myelin segments are separated by a non-myelinated stretch of axon called a node of Ranvier.
    GO:0033088    negative regulation of immature T cell proliferation in thymus    Any process that stops, prevents, or reduces the frequency, rate or extent of immature T cell proliferation in the thymus.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0007528    neuromuscular junction development    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a neuromuscular junction.
    GO:0048709    oligodendrocyte differentiation    The process in which a relatively unspecialized cell acquires the specialized features of an oligodendrocyte. An oligodendrocyte is a type of glial cell involved in myelinating the axons of neurons in the central nervous system.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0007422    peripheral nervous system development    The process whose specific outcome is the progression of the peripheral nervous system over time, from its formation to the mature structure. The peripheral nervous system is one of the two major divisions of the nervous system. Nerves in the PNS connect the central nervous system (CNS) with sensory organs, other organs, muscles, blood vessels and glands.
    GO:0014065    phosphatidylinositol 3-kinase signaling    A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
    GO:0046854    phosphatidylinositol phosphorylation    The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0043406    positive regulation of MAP kinase activity    Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
    GO:0045785    positive regulation of cell adhesion    Any process that activates or increases the frequency, rate or extent of cell adhesion.
    GO:0030307    positive regulation of cell growth    Any process that activates or increases the frequency, rate, extent or direction of cell growth.
    GO:0050679    positive regulation of epithelial cell proliferation    Any process that activates or increases the rate or extent of epithelial cell proliferation.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0090314    positive regulation of protein targeting to membrane    Any process that increases the frequency, rate or extent of the process of directing proteins towards a membrane, usually using signals contained within the protein.
    GO:0045943    positive regulation of transcription from RNA polymerase I promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase I promoter.
    GO:0045945    positive regulation of transcription from RNA polymerase III promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase III promoter.
    GO:0045727    positive regulation of translation    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0070372    regulation of ERK1 and ERK2 cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0045765    regulation of angiogenesis    Any process that modulates the frequency, rate or extent of angiogenesis.
    GO:2000145    regulation of cell motility    Any process that modulates the frequency, rate or extent of cell motility.
    GO:0032886    regulation of microtubule-based process    Any process that modulates the frequency, rate or extent of any cellular process that depends upon or alters the microtubule cytoskeleton.
    GO:0014066    regulation of phosphatidylinositol 3-kinase signaling    Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3h3b)
 
  Sites
(no "Sites" information available for 3h3b)
 
  Cis Peptide Bonds
    Thr C:7 - Pro C:8   [ RasMol ]  
    Thr D:7 - Pro D:8   [ RasMol ]  
    Tyr C:100 - Pro C:101   [ RasMol ]  
    Tyr D:100 - Pro D:101   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3h3b
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ERBB2_HUMAN | P04626
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ERBB2_HUMAN | P04626
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ERBB2_HUMAN | P046261mfg 1mfl 1mw4 1n8z 1ovc 1qr1 1s78 2a91 2jwa 2ks1 2l4k 2n2a 3be1 3mzw 3n85 3pp0 3rcd 3wlw 3wsq 4gfu 4hrl 4hrm 4hrn 4nnd 5k33 5kwg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3H3B)