Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HEPCIDIN-FAB COMPLEX
 
Authors :  R. Syed, V. Li
Date :  10 Apr 09  (Deposition) - 23 Jun 09  (Release) - 13 Oct 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.89
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (2x)
Biol. Unit 2:  A,B,C  (1x)
Keywords :  Peptide-Fab Complex, Antibiotic, Antimicrobial, Cleavage On Pair Of Basic Residues, Disease Mutation, Disulfide Bond, Fungicide, Hormone, Secreted, Immune System/Antimicrobial Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. B. Jordan, L. Poppe, M. Haniu, T. Arvedson, R. Syed, V. Li, H. Kohno, H. Kim, P. D. Schnier, T. S. Harvey, L. P. Miranda, J. Cheetham, B. J. Sasu
Hepcidin Revisited, Disulfide Connectivity, Dynamics, And Structure.
J. Biol. Chem. V. 284 24155 2009
PubMed-ID: 19553669  |  Reference-DOI: 10.1074/JBC.M109.017764
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FAB FRAGMENT, LIGHT CHAIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 2 - FAB FRAGMENT, HEAVY CHAIN
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 3 - HEPCIDIN
    ChainsC
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System Taxid10029
    FragmentUNP RESIDUES 60-84
    GeneHAMP, HEPC, HEPCIDIN, LEAP1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLIVER-EXPRESSED ANTIMICROBIAL PEPTIDE, LEAP-1, PUTATIVE LIVER TUMOR REGRESSOR, PLTR, HEPCIDIN-25, HEPC25, HEPCIDIN-20, HEPC20

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (2x)ABC
Biological Unit 2 (1x)ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3H0T)

(-) Sites  (0, 0)

(no "Site" information available for 3H0T)

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:22 -A:91
2A:138 -A:197
3B:22 -B:99
4B:149 -B:205
5C:7 -C:23
6C:10 -C:13
7C:11 -C:19
8C:14 -C:22

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Tyr A:144 -Pro A:145
2Glu A:214 -Cys A:215
3Cys A:215 -Ser A:216
4Phe B:155 -Pro B:156
5Glu B:157 -Pro B:158
6Cys C:14 -His C:15

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042513C70RHEPC_HUMANDisease (HFE2B)  ---CC11R
2UniProtVAR_026648G71DHEPC_HUMANDisease (HFE2B)104894696CG12D
3UniProtVAR_042514C78YHEPC_HUMANDisease (HFE2B)  ---CC19Y

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042513C70RHEPC_HUMANDisease (HFE2B)  ---CC11R
2UniProtVAR_026648G71DHEPC_HUMANDisease (HFE2B)104894696CG12D
3UniProtVAR_042514C78YHEPC_HUMANDisease (HFE2B)  ---CC19Y

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042513C70RHEPC_HUMANDisease (HFE2B)  ---CC11R
2UniProtVAR_026648G71DHEPC_HUMANDisease (HFE2B)104894696CG12D
3UniProtVAR_042514C78YHEPC_HUMANDisease (HFE2B)  ---CC19Y

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3H0T)

(-) Exons   (1, 1)

Asymmetric Unit (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002223041ENSE00000862777chr19:35773410-35773570161HEPC_HUMAN1-30300--
1.2ENST000002223042ENSE00000700274chr19:35775692-3577575160HEPC_HUMAN31-50200--
1.3ENST000002223043ENSE00000862778chr19:35775841-35776046206HEPC_HUMAN51-84341C:3-2422

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains d3h0ta1 A:1-111 automated matches                                                                              d3h0ta2 A:112-216 automated matches                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee...eeee.....eeeeeee...hhhhh..eeeee......eeeehhhhh........eeeeee....eeeeee...hhhhheeeeeeee....eee...eeeee........eeeee..hhhhhhh..eeeeeeeeee.....eeeeee..eee...eee...ee.....eeeeeeeeehhhhhhh...eeeeeee..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3h0t A   1 NFMLTQPHSVSESPGKTVTISCTRSSGSIASYYVQWYQQRPGSSPTTVIYEDSQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      

Chain B from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3h0tB01 B:1-122 Immunoglobulins                                                                                           3h0tB02 B:123-220 Immunoglobulins                                                                 --- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...ee.....eeeeeeee.........eeeeeeee...eeeeeeeeee...eeeeehhhhhh.ee..ee....eeeeee...hhhhheeeeeeeee....eeeee...eeeee........eeeee..hhh.ee..eeeeeeeeeee.....eeee.hhh.....ee...ee.....eeeeeeeeee.hhh.....eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3h0t B   1 QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWFNDYAVSVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARGIVFSYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK 223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   

Chain C from PDB  Type:PROTEIN  Length:22
 aligned with HEPC_HUMAN | P81172 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:22
                                    71        81  
           HEPC_HUMAN    62 HFPICIFCCGCCHRSKCGMCCK  83
               SCOP domains d3h0tc_ C: Hepcidin    SCOP domains
               CATH domains ---------------------- CATH domains
               Pfam domains ---------------------- Pfam domains
         Sec.struct. author ....eeee.........eeee. Sec.struct. author
                 SAPs(SNPs) --------RD------Y----- SAPs(SNPs)
                    PROSITE ---------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: C:3-24  Transcript 1
                 3h0t C   3 HFPICIFCCGCCHRSKCGMCCK  24
                                    12        22  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric Unit
(-)
Class: Peptides (792)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3H0T)

(-) Gene Ontology  (23, 23)

Asymmetric Unit(hide GO term definitions)
Chain C   (HEPC_HUMAN | P81172)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0097690    iron channel inhibitor activity    Stops, prevents, or reduces the activity of an iron channel.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
    GO:0006879    cellular iron ion homeostasis    Any process involved in the maintenance of an internal steady state of iron ions at the level of a cell.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.
    GO:0060586    multicellular organismal iron ion homeostasis    Any process involved in the maintenance of the distribution of iron stores within tissues and organs of a multicellular organism.
    GO:1904039    negative regulation of ferrous iron export    Any process that stops, prevents or reduces the frequency, rate or extent of iron(2+) export.
    GO:1904479    negative regulation of intestinal absorption    Any process that stops, prevents or reduces the frequency, rate or extent of intestinal absorption.
    GO:0032413    negative regulation of ion transmembrane transporter activity    Any process that stops or reduces the activity of an ion transporter.
    GO:1904255    negative regulation of iron channel activity    Any process that stops, prevents or reduces the frequency, rate or extent of iron channel activity.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:1902916    positive regulation of protein polyubiquitination    Any process that activates or increases the frequency, rate or extent of protein polyubiquitination.
    GO:2000646    positive regulation of receptor catabolic process    Any process that activates or increases the frequency, rate or extent of receptor catabolic process.
    GO:0002092    positive regulation of receptor internalization    Any process that activates or increases the frequency, rate or extent of receptor internalization.
    GO:0010039    response to iron ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus.
cellular component
    GO:0045179    apical cortex    The region that lies just beneath the plasma membrane on the apical edge of a cell.
    GO:0005623    cell    The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3h0t)
 
  Sites
(no "Sites" information available for 3h0t)
 
  Cis Peptide Bonds
    Cys A:215 - Ser A:216   [ RasMol ]  
    Cys C:14 - His C:15   [ RasMol ]  
    Glu A:214 - Cys A:215   [ RasMol ]  
    Glu B:157 - Pro B:158   [ RasMol ]  
    Phe B:155 - Pro B:156   [ RasMol ]  
    Tyr A:144 - Pro A:145   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3h0t
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HEPC_HUMAN | P81172
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  613313
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HEPC_HUMAN | P81172
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HEPC_HUMAN | P811721m4e 1m4f 2kef 4qae

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3H0T)