Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HUMAN PALMITOYL-PROTEIN THIOESTERASE 1
 
Authors :  E. Dobrovetsky, A. Seitova, Y. Tong, W. Tempel, A. Dong, C. H. Arrowsmith, A. M. Edwards, C. Bountra, J. Weigelt, A. Bochkarev, D. Cossar, H. Park, Structural Genomics Consortium (Sgc)
Date :  26 Mar 09  (Deposition) - 07 Apr 09  (Release) - 07 Apr 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.53
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Neuronal Ceroid Lipofuscinosis, Neurodegeneration, Structural Genomics Consortium, Sgc, Disease Mutation, Disulfide Bond, Glycoprotein, Hydrolase, Lysosome, Polymorphism, Sensory Transduction, Vision (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Dobrovetsky, A. Seitova, Y. Tong, W. Tempel, A. Dong, C. H. Arrowsmith, A. M. Edwards, C. Bountra, J. Weigelt, A. Bochkarev, D. Cossar, H. Park
Human Palmitoyl-Protein Thioesterase 1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PALMITOYL-PROTEIN THIOESTERASE 1
    ChainsA, B
    EC Number3.1.2.22
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF9
    Expression System CommonFALL ARMYWORM
    Expression System PlasmidPFHMSP-LIC-C
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    GenePPT1, PPT
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPPT-1, PALMITOYL-PROTEIN HYDROLASE 1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 22)

Asymmetric/Biological Unit (2, 22)
No.NameCountTypeFull Name
1MSE18Mod. Amino AcidSELENOMETHIONINE
2UNX4Ligand/IonUNKNOWN ATOM OR ION

(-) Sites  (0, 0)

(no "Site" information available for 3GRO)

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:45 -A:46
2A:96 -A:128
3A:152 -A:160
4B:45 -B:46
5B:96 -B:128
6B:152 -B:160

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ser A:130 -Pro A:131
2Asp A:237 -Pro A:238
3Ser B:130 -Pro B:131
4Asp B:237 -Pro B:238

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (24, 48)

Asymmetric/Biological Unit (24, 48)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_058434W38CPPT1_HUMANDisease (CLN1)386833626A/BW38C
02UniProtVAR_005548H39QPPT1_HUMANDisease (CLN1)386833627A/BH39Q
03UniProtVAR_005549G42EPPT1_HUMANDisease (CLN1)386833631A/BG42E
04UniProtVAR_066874C45YPPT1_HUMANDisease (CLN1)137852702A/BC45Y
05UniProtVAR_005550T75PPPT1_HUMANDisease (CLN1)137852696A/BT75P
06UniProtVAR_005551D79GPPT1_HUMANDisease (CLN1)137852697A/BD79G
07UniProtVAR_018511G108RPPT1_HUMANDisease (CLN1)137852701A/BG108R
08UniProtVAR_005552Y109DPPT1_HUMANDisease (CLN1)386833642A/BY109D
09UniProtVAR_005553R122WPPT1_HUMANDisease (CLN1)137852695A/BR122W
10UniProtVAR_005554I134TPPT1_HUMANPolymorphism1800205A/BI134T
11UniProtVAR_066875S138LPPT1_HUMANDisease (CLN1)386833646A/BS138L
12UniProtVAR_066876C152YPPT1_HUMANDisease (CLN1)386833647A/BC152Y
13UniProtVAR_005555Q177EPPT1_HUMANDisease (CLN1)386833650A/BQ177E
14UniProtVAR_005556V181LPPT1_HUMANDisease (CLN1)148412181A/BV181L
15UniProtVAR_005557V181MPPT1_HUMANDisease (CLN1)148412181A/BV181M
16UniProtVAR_066877H187RPPT1_HUMANDisease (CLN1)386833657A/BH187R
17UniProtVAR_066878P189RPPT1_HUMANDisease (CLN1)386833658A/BP189R
18UniProtVAR_005558L219QPPT1_HUMANDisease (CLN1)137852698A/BL219Q
19UniProtVAR_066879L222PPPT1_HUMANDisease (CLN1)386833661A/BL222P
20UniProtVAR_066880V228GPPT1_HUMANDisease (CLN1)386833663A/BV228G
21UniProtVAR_005559Y247HPPT1_HUMANDisease (CLN1)386833665A/BY247H
22UniProtVAR_005560G250VPPT1_HUMANDisease (CLN1)386833666A/BG250V
23UniProtVAR_066881W296RPPT1_HUMANDisease (CLN1)386833669A/BW296R
24UniProtVAR_066882L305PPPT1_HUMANDisease (CLN1)386833671A/BL305P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3GRO)

(-) Exons   (0, 0)

(no "Exon" information available for 3GRO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:277
 aligned with PPT1_HUMAN | P50897 from UniProtKB/Swiss-Prot  Length:306

    Alignment length:277
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       
           PPT1_HUMAN    30 PAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG 306
               SCOP domains d3groa_ A: automated matches                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 3groA00 A:30-306  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee...........hhhhhhhhhhhhh....eee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeehhhhhhhhhhhhhh....eeeeeee................hhhhhhhhhhhhhhhh.hhhhhh.hhhhhhh....hhhhhhhhh.hhhhhh.....hhhhhhhhhh..eeeeeee.......hhhhhhh.ee.......eehhhhhhhhhh...hhhhhhhh..eeeeee.......hhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------CQ--E--Y-----------------------------P---G----------------------------RD------------W-----------T---L-------------Y------------------------E---L-----R-R-----------------------------Q--P-----G------------------H--V---------------------------------------------R--------P- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------------M----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3gro A  30 PAPLPLVIWHGmGDSCCNPLSmGAIKKmVEKKIPGIYVLSLEIGKTLmEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAmGFSQGGQFLRAVAQRCPSPPmINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLmALKKFVmVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEmDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG 306
                                    39 |      49 |     |59        69       |79        89        99       109  |    119       129   |   139       149       159       169       179       189       199       209       219|      229       239       249       259       269    |  279       289       299       
                                      41-MSE    51-MSE |                  77-MSE                            112-MSE              133-MSE                                                                                220-MSE  |                                            274-MSE                            
                                                      57-MSE                                                                                                                                                                   227-MSE                                                                           

Chain B from PDB  Type:PROTEIN  Length:275
 aligned with PPT1_HUMAN | P50897 from UniProtKB/Swiss-Prot  Length:306

    Alignment length:275
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300     
           PPT1_HUMAN    31 APLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFL 305
               SCOP domains d3grob_ B: automated matches                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 3groB00 B:31-305  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee...........hhhhhhhhhhhhh....eee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhh....eeeeeee................hhhhhhhhhhhhhhhh.hhhhhh.hhhhhh.....hhhhhhhhh.hhhhhh.....hhhhhhhhh...eeeeeee.......hhhhhhh.ee.......eehhhhhhhhhh...hhhhhhhh..eeeeee.......hhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------CQ--E--Y-----------------------------P---G----------------------------RD------------W-----------T---L-------------Y------------------------E---L-----R-R-----------------------------Q--P-----G------------------H--V---------------------------------------------R--------P SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------M---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3gro B  31 APLPLVIWHGmGDSCCNPLSmGAIKKmVEKKIPGIYVLSLEIGKTLmEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAmGFSQGGQFLRAVAQRCPSPPmINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLmALKKFVmVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEmDNAGQLVFLATEGDHLQLSEEWFYAHIIPFL 305
                                    40|       50|     | 60        70      | 80        90       100       110 |     120       130  |    140       150       160       170       180       190       200       210       220      |230       240       250       260       270   |   280       290       300     
                                     41-MSE    51-MSE |                  77-MSE                            112-MSE              133-MSE                                                                                220-MSE  |                                            274-MSE                           
                                                     57-MSE                                                                                                                                                                   227-MSE                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3GRO)

(-) Gene Ontology  (52, 52)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (PPT1_HUMAN | P50897)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0098599    palmitoyl hydrolase activity    Catalysis of a hydrolase reaction that removes a palmitoyl moiety from some substrate.
    GO:0008474    palmitoyl-(protein) hydrolase activity    Catalysis of the reaction: palmitoyl-protein + H2O = palmitate + protein.
    GO:0016290    palmitoyl-CoA hydrolase activity    Catalysis of the reaction: palmitoyl-CoA + H2O = CoA + palmitate.
biological process
    GO:0008344    adult locomotory behavior    Locomotory behavior in a fully developed and mature organism.
    GO:0008306    associative learning    Learning by associating a stimulus (the cause) with a particular outcome (the effect).
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:0044265    cellular macromolecule catabolic process    The chemical reactions and pathways resulting in the breakdown of a macromolecule, any large molecule including proteins, nucleic acids and carbohydrates, as carried out by individual cells.
    GO:0044257    cellular protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by individual cells.
    GO:0007268    chemical synaptic transmission    The vesicular release of classical neurotransmitter molecules from a presynapse, across a chemical synapse, the subsequent activation of neurotransmitter receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
    GO:0051186    cofactor metabolic process    The chemical reactions and pathways involving a cofactor, a substance that is required for the activity of an enzyme or other protein. Cofactors may be inorganic, such as the metal atoms zinc, iron, and copper in certain forms, or organic, in which case they are referred to as coenzymes. Cofactors may either be bound tightly to active sites or bind loosely with the substrate.
    GO:0051181    cofactor transport    The directed movement of a cofactor into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. A cofactor is a substance that is required for the activity of an enzyme or other protein.
    GO:0007625    grooming behavior    The specific behavior of an organism relating to grooming, cleaning and brushing to remove dirt and parasites.
    GO:0016042    lipid catabolic process    The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0035338    long-chain fatty-acyl-CoA biosynthetic process    The chemical reactions and pathways resulting in the formation of a long-chain fatty-acyl-CoA any derivative of coenzyme A in which the sulfhydryl group is in a thioester linkage with a long-chain fatty-acyl group. Long-chain fatty-acyl-CoAs have chain lengths of C13 or more.
    GO:0007042    lysosomal lumen acidification    Any process that reduces the pH of the lysosomal lumen, measured by the concentration of the hydrogen ion.
    GO:0007040    lysosome organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a lysosome. A lysosome is a cytoplasmic, membrane-bounded organelle that is found in most animal cells and that contains a variety of hydrolases.
    GO:0031579    membrane raft organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of membrane rafts, small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0048666    neuron development    The process whose specific outcome is the progression of a neuron over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell.
    GO:0007269    neurotransmitter secretion    The regulated release of neurotransmitter from the presynapse into the synaptic cleft via calcium regualated exocytosis during synaptic transmission.
    GO:0006907    pinocytosis    An endocytosis process that results in the uptake of liquid material by cells from their external environment; literally 'cell drinking'. Liquid is enclosed in vesicles, called pinosomes, formed by invagination of the plasma membrane.
    GO:0048549    positive regulation of pinocytosis    Any process that activates, maintains or increases the rate of pinocytosis. Pinocytosis is the process in which cells take in liquid material from their external environment; literally 'cell drinking'. Liquid is enclosed in vesicles, formed by invagination of the plasma membrane. These vesicles then move into the cell and pass their contents to endosomes.
    GO:0048260    positive regulation of receptor-mediated endocytosis    Any process that activates or increases the frequency, rate or extent of receptor mediated endocytosis, the uptake of external materials by cells, utilizing receptors to ensure specificity of transport.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0002084    protein depalmitoylation    The removal of palymitoyl groups from a lipoprotein.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
    GO:0032429    regulation of phospholipase A2 activity    Any process that modulates the activity of the enzyme phospholipase A2.
    GO:0050803    regulation of synapse structure or activity    Any process that modulates the physical form or the activity of a synapse, the junction between a neuron and a target (neuron, muscle, or secretory cell).
    GO:0050896    response to stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
    GO:0030149    sphingolipid catabolic process    The chemical reactions and pathways resulting in the breakdown of sphingolipids, any of a class of lipids containing the long-chain amine diol sphingosine or a closely related base (a sphingoid).
    GO:0007601    visual perception    The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043202    lysosomal lumen    The volume enclosed within the lysosomal membrane.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0045202    synapse    The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.
    GO:0008021    synaptic vesicle    A secretory organelle, typically 50 nm in diameter, of presynaptic nerve terminals; accumulates in high concentrations of neurotransmitters and secretes these into the synaptic cleft by fusion with the 'active zone' of the presynaptic plasma membrane.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3gro)
 
  Cis Peptide Bonds
    Asp A:237 - Pro A:238   [ RasMol ]  
    Asp B:237 - Pro B:238   [ RasMol ]  
    Ser A:130 - Pro A:131   [ RasMol ]  
    Ser B:130 - Pro B:131   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3gro
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PPT1_HUMAN | P50897
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.2.22
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  256730
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PPT1_HUMAN | P50897
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3GRO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3GRO)