3DRU - JenaLib

Asymmetric Unit (32, 95)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_006980	A	58	T	A1AT_HUMAN	Polymorphism	149319176	A/B/C	A	34	T
02	UniProt	VAR_006981	R	63	C	A1AT_HUMAN	Polymorphism	28931570	A/B/C	R	39	C
03	UniProt	VAR_006982	L	65	P	A1AT_HUMAN	Polymorphism	28931569	A/B/C	L	41	P
04	UniProt	VAR_006983	S	69	F	A1AT_HUMAN	Polymorphism	199687431	A/B/C	S	45	F
05	UniProt	VAR_006985	S	77	F	A1AT_HUMAN	Polymorphism	55819880	A/B/C	S	53	F
06	UniProt	VAR_006986	A	84	T	A1AT_HUMAN	Polymorphism	111850950	A/B/C	A	60	T
07	UniProt	VAR_006987	G	91	E	A1AT_HUMAN	Polymorphism	28931568	A/B/C	G	67	E
08	UniProt	VAR_006988	T	92	I	A1AT_HUMAN	Unclassified	---	A/B/C	T	68	I
09	UniProt	VAR_011620	T	109	M	A1AT_HUMAN	Polymorphism	199422213	A/B/C	T	85	M
10	UniProt	VAR_006989	P	112	T	A1AT_HUMAN	Unclassified	---	A/B/C	P	88	T
11	UniProt	VAR_006990	I	116	N	A1AT_HUMAN	Polymorphism	28931572	A/B/C	I	92	N
12	UniProt	VAR_006991	R	125	H	A1AT_HUMAN	Polymorphism	709932	A/B/C	R	101	H
13	UniProt	VAR_006992	G	139	S	A1AT_HUMAN	Polymorphism	11558261	A/B/C	G	115	S
14	UniProt	VAR_006993	G	172	R	A1AT_HUMAN	Polymorphism	112030253	A/B/C	G	148	R
15	UniProt	VAR_006994	G	172	W	A1AT_HUMAN	Polymorphism	112030253	A/B/C	G	148	W
16	UniProt	VAR_006995	Q	180	E	A1AT_HUMAN	Unclassified	---	A/B/C	Q	156	E
17	UniProt	VAR_006996	E	228	K	A1AT_HUMAN	Polymorphism	199422208	A/B/C	E	204	K
18	UniProt	VAR_006997	V	237	A	A1AT_HUMAN	Polymorphism	6647	A/B/C	V	213	A
19	UniProt	VAR_006998	R	247	C	A1AT_HUMAN	Polymorphism	28929470	A/B/C	R	223	C
20	UniProt	VAR_006999	D	280	V	A1AT_HUMAN	Polymorphism	28929472	A/B/C	D	256	V
21	UniProt	VAR_007000	E	288	V	A1AT_HUMAN	Polymorphism	17580	A/B/C	E	264	V
22	UniProt	VAR_007001	S	354	F	A1AT_HUMAN	Polymorphism	201788603	A/B/C	S	330	F
23	UniProt	VAR_007002	A	360	T	A1AT_HUMAN	Polymorphism	1802959	A/B/C	A	336	T
24	UniProt	VAR_007003	D	365	N	A1AT_HUMAN	Polymorphism	143370956	A/B/C	D	341	N
25	UniProt	VAR_007004	E	366	K	A1AT_HUMAN	Polymorphism	28929474	A/B/C	E	342	K
26	UniProt	VAR_007005	M	382	R	A1AT_HUMAN	Polymorphism	121912713	A/B	M	358	R
27	UniProt	VAR_007006	P	386	H	A1AT_HUMAN	Unclassified	---	A/B/C	P	362	H
28	UniProt	VAR_007007	P	386	T	A1AT_HUMAN	Polymorphism	12233	A/B/C	P	362	T
29	UniProt	VAR_007008	E	387	K	A1AT_HUMAN	Polymorphism	121912712	A/B/C	E	363	K
30	UniProt	VAR_007009	P	393	L	A1AT_HUMAN	Polymorphism	199422209	A/B/C	P	369	L
31	UniProt	VAR_007010	E	400	D	A1AT_HUMAN	Polymorphism	1303	A/B/C	E	376	D
32	UniProt	VAR_007011	P	415	H	A1AT_HUMAN	Unclassified	---	A/B/C	P	391	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (32, 32)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_006980	A	58	T	A1AT_HUMAN	Polymorphism	149319176	A	A	34	T
02	UniProt	VAR_006981	R	63	C	A1AT_HUMAN	Polymorphism	28931570	A	R	39	C
03	UniProt	VAR_006982	L	65	P	A1AT_HUMAN	Polymorphism	28931569	A	L	41	P
04	UniProt	VAR_006983	S	69	F	A1AT_HUMAN	Polymorphism	199687431	A	S	45	F
05	UniProt	VAR_006985	S	77	F	A1AT_HUMAN	Polymorphism	55819880	A	S	53	F
06	UniProt	VAR_006986	A	84	T	A1AT_HUMAN	Polymorphism	111850950	A	A	60	T
07	UniProt	VAR_006987	G	91	E	A1AT_HUMAN	Polymorphism	28931568	A	G	67	E
08	UniProt	VAR_006988	T	92	I	A1AT_HUMAN	Unclassified	---	A	T	68	I
09	UniProt	VAR_011620	T	109	M	A1AT_HUMAN	Polymorphism	199422213	A	T	85	M
10	UniProt	VAR_006989	P	112	T	A1AT_HUMAN	Unclassified	---	A	P	88	T
11	UniProt	VAR_006990	I	116	N	A1AT_HUMAN	Polymorphism	28931572	A	I	92	N
12	UniProt	VAR_006991	R	125	H	A1AT_HUMAN	Polymorphism	709932	A	R	101	H
13	UniProt	VAR_006992	G	139	S	A1AT_HUMAN	Polymorphism	11558261	A	G	115	S
14	UniProt	VAR_006993	G	172	R	A1AT_HUMAN	Polymorphism	112030253	A	G	148	R
15	UniProt	VAR_006994	G	172	W	A1AT_HUMAN	Polymorphism	112030253	A	G	148	W
16	UniProt	VAR_006995	Q	180	E	A1AT_HUMAN	Unclassified	---	A	Q	156	E
17	UniProt	VAR_006996	E	228	K	A1AT_HUMAN	Polymorphism	199422208	A	E	204	K
18	UniProt	VAR_006997	V	237	A	A1AT_HUMAN	Polymorphism	6647	A	V	213	A
19	UniProt	VAR_006998	R	247	C	A1AT_HUMAN	Polymorphism	28929470	A	R	223	C
20	UniProt	VAR_006999	D	280	V	A1AT_HUMAN	Polymorphism	28929472	A	D	256	V
21	UniProt	VAR_007000	E	288	V	A1AT_HUMAN	Polymorphism	17580	A	E	264	V
22	UniProt	VAR_007001	S	354	F	A1AT_HUMAN	Polymorphism	201788603	A	S	330	F
23	UniProt	VAR_007002	A	360	T	A1AT_HUMAN	Polymorphism	1802959	A	A	336	T
24	UniProt	VAR_007003	D	365	N	A1AT_HUMAN	Polymorphism	143370956	A	D	341	N
25	UniProt	VAR_007004	E	366	K	A1AT_HUMAN	Polymorphism	28929474	A	E	342	K
26	UniProt	VAR_007005	M	382	R	A1AT_HUMAN	Polymorphism	121912713	A	M	358	R
27	UniProt	VAR_007006	P	386	H	A1AT_HUMAN	Unclassified	---	A	P	362	H
28	UniProt	VAR_007007	P	386	T	A1AT_HUMAN	Polymorphism	12233	A	P	362	T
29	UniProt	VAR_007008	E	387	K	A1AT_HUMAN	Polymorphism	121912712	A	E	363	K
30	UniProt	VAR_007009	P	393	L	A1AT_HUMAN	Polymorphism	199422209	A	P	369	L
31	UniProt	VAR_007010	E	400	D	A1AT_HUMAN	Polymorphism	1303	A	E	376	D
32	UniProt	VAR_007011	P	415	H	A1AT_HUMAN	Unclassified	---	A	P	391	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (32, 32)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_006980	A	58	T	A1AT_HUMAN	Polymorphism	149319176	B	A	34	T
02	UniProt	VAR_006981	R	63	C	A1AT_HUMAN	Polymorphism	28931570	B	R	39	C
03	UniProt	VAR_006982	L	65	P	A1AT_HUMAN	Polymorphism	28931569	B	L	41	P
04	UniProt	VAR_006983	S	69	F	A1AT_HUMAN	Polymorphism	199687431	B	S	45	F
05	UniProt	VAR_006985	S	77	F	A1AT_HUMAN	Polymorphism	55819880	B	S	53	F
06	UniProt	VAR_006986	A	84	T	A1AT_HUMAN	Polymorphism	111850950	B	A	60	T
07	UniProt	VAR_006987	G	91	E	A1AT_HUMAN	Polymorphism	28931568	B	G	67	E
08	UniProt	VAR_006988	T	92	I	A1AT_HUMAN	Unclassified	---	B	T	68	I
09	UniProt	VAR_011620	T	109	M	A1AT_HUMAN	Polymorphism	199422213	B	T	85	M
10	UniProt	VAR_006989	P	112	T	A1AT_HUMAN	Unclassified	---	B	P	88	T
11	UniProt	VAR_006990	I	116	N	A1AT_HUMAN	Polymorphism	28931572	B	I	92	N
12	UniProt	VAR_006991	R	125	H	A1AT_HUMAN	Polymorphism	709932	B	R	101	H
13	UniProt	VAR_006992	G	139	S	A1AT_HUMAN	Polymorphism	11558261	B	G	115	S
14	UniProt	VAR_006993	G	172	R	A1AT_HUMAN	Polymorphism	112030253	B	G	148	R
15	UniProt	VAR_006994	G	172	W	A1AT_HUMAN	Polymorphism	112030253	B	G	148	W
16	UniProt	VAR_006995	Q	180	E	A1AT_HUMAN	Unclassified	---	B	Q	156	E
17	UniProt	VAR_006996	E	228	K	A1AT_HUMAN	Polymorphism	199422208	B	E	204	K
18	UniProt	VAR_006997	V	237	A	A1AT_HUMAN	Polymorphism	6647	B	V	213	A
19	UniProt	VAR_006998	R	247	C	A1AT_HUMAN	Polymorphism	28929470	B	R	223	C
20	UniProt	VAR_006999	D	280	V	A1AT_HUMAN	Polymorphism	28929472	B	D	256	V
21	UniProt	VAR_007000	E	288	V	A1AT_HUMAN	Polymorphism	17580	B	E	264	V
22	UniProt	VAR_007001	S	354	F	A1AT_HUMAN	Polymorphism	201788603	B	S	330	F
23	UniProt	VAR_007002	A	360	T	A1AT_HUMAN	Polymorphism	1802959	B	A	336	T
24	UniProt	VAR_007003	D	365	N	A1AT_HUMAN	Polymorphism	143370956	B	D	341	N
25	UniProt	VAR_007004	E	366	K	A1AT_HUMAN	Polymorphism	28929474	B	E	342	K
26	UniProt	VAR_007005	M	382	R	A1AT_HUMAN	Polymorphism	121912713	B	M	358	R
27	UniProt	VAR_007006	P	386	H	A1AT_HUMAN	Unclassified	---	B	P	362	H
28	UniProt	VAR_007007	P	386	T	A1AT_HUMAN	Polymorphism	12233	B	P	362	T
29	UniProt	VAR_007008	E	387	K	A1AT_HUMAN	Polymorphism	121912712	B	E	363	K
30	UniProt	VAR_007009	P	393	L	A1AT_HUMAN	Polymorphism	199422209	B	P	369	L
31	UniProt	VAR_007010	E	400	D	A1AT_HUMAN	Polymorphism	1303	B	E	376	D
32	UniProt	VAR_007011	P	415	H	A1AT_HUMAN	Unclassified	---	B	P	391	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (31, 31)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_006980	A	58	T	A1AT_HUMAN	Polymorphism	149319176	C	A	34	T
02	UniProt	VAR_006981	R	63	C	A1AT_HUMAN	Polymorphism	28931570	C	R	39	C
03	UniProt	VAR_006982	L	65	P	A1AT_HUMAN	Polymorphism	28931569	C	L	41	P
04	UniProt	VAR_006983	S	69	F	A1AT_HUMAN	Polymorphism	199687431	C	S	45	F
05	UniProt	VAR_006985	S	77	F	A1AT_HUMAN	Polymorphism	55819880	C	S	53	F
06	UniProt	VAR_006986	A	84	T	A1AT_HUMAN	Polymorphism	111850950	C	A	60	T
07	UniProt	VAR_006987	G	91	E	A1AT_HUMAN	Polymorphism	28931568	C	G	67	E
08	UniProt	VAR_006988	T	92	I	A1AT_HUMAN	Unclassified	---	C	T	68	I
09	UniProt	VAR_011620	T	109	M	A1AT_HUMAN	Polymorphism	199422213	C	T	85	M
10	UniProt	VAR_006989	P	112	T	A1AT_HUMAN	Unclassified	---	C	P	88	T
11	UniProt	VAR_006990	I	116	N	A1AT_HUMAN	Polymorphism	28931572	C	I	92	N
12	UniProt	VAR_006991	R	125	H	A1AT_HUMAN	Polymorphism	709932	C	R	101	H
13	UniProt	VAR_006992	G	139	S	A1AT_HUMAN	Polymorphism	11558261	C	G	115	S
14	UniProt	VAR_006993	G	172	R	A1AT_HUMAN	Polymorphism	112030253	C	G	148	R
15	UniProt	VAR_006994	G	172	W	A1AT_HUMAN	Polymorphism	112030253	C	G	148	W
16	UniProt	VAR_006995	Q	180	E	A1AT_HUMAN	Unclassified	---	C	Q	156	E
17	UniProt	VAR_006996	E	228	K	A1AT_HUMAN	Polymorphism	199422208	C	E	204	K
18	UniProt	VAR_006997	V	237	A	A1AT_HUMAN	Polymorphism	6647	C	V	213	A
19	UniProt	VAR_006998	R	247	C	A1AT_HUMAN	Polymorphism	28929470	C	R	223	C
20	UniProt	VAR_006999	D	280	V	A1AT_HUMAN	Polymorphism	28929472	C	D	256	V
21	UniProt	VAR_007000	E	288	V	A1AT_HUMAN	Polymorphism	17580	C	E	264	V
22	UniProt	VAR_007001	S	354	F	A1AT_HUMAN	Polymorphism	201788603	C	S	330	F
23	UniProt	VAR_007002	A	360	T	A1AT_HUMAN	Polymorphism	1802959	C	A	336	T
24	UniProt	VAR_007003	D	365	N	A1AT_HUMAN	Polymorphism	143370956	C	D	341	N
25	UniProt	VAR_007004	E	366	K	A1AT_HUMAN	Polymorphism	28929474	C	E	342	K
27	UniProt	VAR_007006	P	386	H	A1AT_HUMAN	Unclassified	---	C	P	362	H
28	UniProt	VAR_007007	P	386	T	A1AT_HUMAN	Polymorphism	12233	C	P	362	T
29	UniProt	VAR_007008	E	387	K	A1AT_HUMAN	Polymorphism	121912712	C	E	363	K
30	UniProt	VAR_007009	P	393	L	A1AT_HUMAN	Polymorphism	199422209	C	P	369	L
31	UniProt	VAR_007010	E	400	D	A1AT_HUMAN	Polymorphism	1303	C	E	376	D
32	UniProt	VAR_007011	P	415	H	A1AT_HUMAN	Unclassified	---	C	P	391	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 3)

Exons (4, 12)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:363
 aligned with A1AT_HUMAN | P01009 from UniProtKB/Swiss-Prot  Length:418

    Alignment length:371
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417 
           A1AT_HUMAN    48 NKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK 418
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3druA01 A:24-194,A:290-343 Antithrombin, subunit I, domain 2                                                                                                               3druA02 A:195-289,A:344-394 Alpha-1-antitrypsin, domain 1                                      3druA01 A:24-194,A:290-343                            3druA        02 A:195-289,A:344-394                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhh.......eeehhhhhhhhhhhhhh..hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh......eeeeeeeeee.....hhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhhh................eeeeeeeeee............eeeee.......eeeee..eeeee..eee....eeeeeee.....eeeeeee...hhhhhhhhhhhhhhhhhhhh...eeeeee....eeeeeeehhhhhhhh........................eeeeeeeee.........--------......eee....eeeeee......eeeeeee...... Sec.struct. author
             SAPs(SNPs) (1) ----------T----C-P---F-------F------T------EI----------------M--T---N--------H-------------S--------------------------------R-------E-----------------------------------------------K--------A---------C--------------------------------V-------V-----------------------------------------------------------------F-----T----NK---------------R---HK-----L------D--------------H--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------W---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T-------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SERPIN     -------------------- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: A:24-192 UniProt: 1-216 [INCOMPLETE]                                                                                                                     -----------------------------------------------------------------------------------------Exon 1.5a  PDB: A:282-331 UniProt: 306-355        Exon 1.6b  PDB: A:332-394 (gaps) UniProt: 356-418               Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: A:192-282 UniProt: 216-306                                                 ---------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3dru A  24 NKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNFLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAA--------PMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK 394
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343    |    -   |   363       373       383       393 
                                                                                                                                                                                                                                                                                                                                                              348      357

Chain B from PDB  Type:PROTEIN  Length:362
 aligned with A1AT_HUMAN | P01009 from UniProtKB/Swiss-Prot  Length:418

    Alignment length:371
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416 
           A1AT_HUMAN    47 FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQ 417
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3druB01 B:23-194,B:290-343 Antithrombin, subunit I, domain 2                                                                                                                3druB02 B:195-289,B:344-393 Alpha-1-antitrypsin, domain 1                                      3druB01 B:23-194,B:290-343                            3dru         B02 B:195-289,B:344-393               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhh.......eeehhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeee.....hhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhhh................eeeeeeeeee.......hhhhheee...........eee.....ee..eee....eeeeeeee...eeeeeeee...hhhhhhhhhhhhhhhhhhhh...ee.eee....eeeeeeehhhhhhhh..hhhhh.................eeeeeeeee........---------......eee....eeeeeee.....eeeeeee..... Sec.struct. author
             SAPs(SNPs) (1) -----------T----C-P---F-------F------T------EI----------------M--T---N--------H-------------S--------------------------------R-------E-----------------------------------------------K--------A---------C--------------------------------V-------V-----------------------------------------------------------------F-----T----NK---------------R---HK-----L------D--------------H-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------W---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------------- SAPs(SNPs) (2)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SERPIN     ------------------- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: B:23-192 UniProt: 1-216 [INCOMPLETE]                                                                                                                      -----------------------------------------------------------------------------------------Exon 1.5a  PDB: B:282-331 UniProt: 306-355        Exon 1.6b  PDB: B:332-393 (gaps) UniProt: 356-418 [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: B:192-282 UniProt: 216-306                                                 --------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3dru B  23 FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNFLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEA---------PMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQ 393
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342    |    -    |  362       372       382       392 
                                                                                                                                                                                                                                                                                                                                                              347       357

Chain C from PDB  Type:PROTEIN  Length:360
 aligned with A1AT_HUMAN | P01009 from UniProtKB/Swiss-Prot  Length:418

    Alignment length:371
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416 
           A1AT_HUMAN    47 FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQ 417
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3druC01 C:23-194,C:290-343 Antithrombin, subunit I, domain 2                                                                                                                3druC02 C:195-289,C:344-393 Alpha-1-antitrypsin, domain 1                                      3druC01 C:23-194,C:290-343                            3dru           C02 C:195-289,C:344-393             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh......eeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh........ee..eeeee.....hhhhhhhhhhhh..eeeee......hhhhhhhhhhhhh.................eeeeeeeee........hhhhheeeee.......eeeeeeeeeeee..eee....eeeeeee....eeeeeeee...hhhhhhhhhhhhhhhhhhhh...eeeeeeee..eeeeeeehhhhhhhh........................eeeeeeeee........-----------....eee....eeeeeee.....eeeeeee..... Sec.struct. author
             SAPs(SNPs) (1) -----------T----C-P---F-------F------T------EI----------------M--T---N--------H-------------S--------------------------------R-------E-----------------------------------------------K--------A---------C--------------------------------V-------V-----------------------------------------------------------------F-----T----NK-------------------HK-----L------D--------------H-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------W---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------------- SAPs(SNPs) (2)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SERPIN     ------------------- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: C:23-192 UniProt: 1-216 [INCOMPLETE]                                                                                                                      -----------------------------------------------------------------------------------------Exon 1.5a  PDB: C:282-331 UniProt: 306-355        Exon 1.6b  PDB: C:332-393 (gaps) UniProt: 356-418 [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: C:192-282 UniProt: 216-306                                                 --------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3dru C  23 FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNFLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEA-----------SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQ 393
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342    |    -      |362       372       382       392 
                                                                                                                                                                                                                                                                                                                                                              347         359

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 6)

Pfam Domains (0, 0)

Gene Ontology (24, 24)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (A1AT_HUMAN | P01009)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0002020	protease binding	Interacting selectively and non-covalently with any protease or peptidase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0048208	COPII vesicle coating	The addition of COPII proteins and adaptor proteins to ER membranes during the formation of transport vesicles, forming a vesicle coat.
	GO:0006888	ER to Golgi vesicle-mediated transport	The directed movement of substances from the endoplasmic reticulum (ER) to the Golgi, mediated by COP II vesicles. Small COP II coated vesicles form from the ER and then fuse directly with the cis-Golgi. Larger structures are transported along microtubules to the cis-Golgi.
	GO:0006953	acute-phase response	An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0007599	hemostasis	The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
cellular component
	GO:0030134	COPII-coated ER to Golgi transport vesicle	A vesicle with a coat formed of the COPII coat complex proteins. The COPII coat complex is formed by the Sec23p/Sec24p and the Sec13p/Sec31p heterodimers. COPII-associated vesicles transport proteins from the rough endoplasmic reticulum to the Golgi apparatus (anterograde transport).
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005788	endoplasmic reticulum lumen	The volume enclosed by the membranes of the endoplasmic reticulum.
	GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	The lipid bilayer surrounding any of the compartments of the endoplasmic reticulum (ER)-Golgi intermediate compartment system.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0031093	platelet alpha granule lumen	The volume enclosed by the membrane of the platelet alpha granule.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (32, 95)

PROSITE Motifs (1, 3)

Exons (4, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 6)

Pfam Domains (0, 0)

Gene Ontology (24, 24)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File