3DI2 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE COMPLEX OF HUMAN INTERLEUKIN-7 WITH UNGLYCOSYLATED HUMAN INTERLEUKIN-7 RECEPTOR ALPHA ECTODOMAIN

Authors :   C. A. Mcelroy, J. A. Dohm, S. T. R. Walsh

Date :   19 Jun 08 (Deposition) - 27 Jan 09 (Release) - 27 Jan 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Interleukin, Cytokine, Cytokine Receptor, Ectodomain, Glycoprotein, Growth Factor, Secreted, Alternative Splicing, Disease Mutation, Membrane, Phosphoprotein, Polymorphism, Receptor, Scid, Transmembrane, Cytokine/Cytokine Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. A. Mcelroy, J. A. Dohm, S. T. Walsh
Structural And Biophysical Studies Of The Human Il-7/Il-7Ralpha Complex.
Structure V. 17 54 2009
PubMed-ID: 19141282 | Reference-DOI: 10.1016/J.STR.2008.10.019
(for further references see the PDB file header)

Molecule 1 - INTERLEUKIN-7
	Chains	:	A, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-15B
	Expression System Strain	:	BL21(DE3) CODON PLUS RP
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 26 TO 177
	Gene	:	IL7
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IL-7

Molecule 2 - INTERLEUKIN-7 RECEPTOR SUBUNIT ALPHA
	Chains	:	B, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-15B
	Expression System Strain	:	BL21(DE3) CODON PLUS RP
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 21 TO 239 (LIGAND BINDING ECTODOMAIN)
	Gene	:	IL7R
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IL-7R-ALPHA, CD127 ANTIGEN, CDW127

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	1PE	1	Ligand/Ion	PENTAETHYLENE GLYCOL

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	1PE	1	Ligand/Ion	PENTAETHYLENE GLYCOL

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	1PE	-1	Ligand/Ion	PENTAETHYLENE GLYCOL

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:8 , ASN A:91	BINDING SITE FOR RESIDUE 1PE A 340

Asymmetric Unit

No.	Residues
1	A:34	-	A:129
2	A:47	-	A:141
3	B:22	-	B:37
4	B:54	-	B:62
5	B:88	-	B:98
6	C:34	-	C:129
7	C:47	-	C:141
8	D:22	-	D:37
9	D:54	-	D:62
10	D:88	-	D:98

(no "Cis Peptide Bond" information available for 3DI2)

Asymmetric Unit (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021286	T	66	I	IL7RA_HUMAN	Disease (T(-)	1494558	B/D	T	46	I
2	UniProt	VAR_021287	E	113	D	IL7RA_HUMAN	Polymorphism	11567735	B/D	E	93	D
3	UniProt	VAR_034870	P	132	S	IL7RA_HUMAN	Disease (T(-)	---	B/D	P	112	S
4	UniProt	VAR_021288	I	138	V	IL7RA_HUMAN	Disease (T(-)	1494555	B/D	V	118	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021286	T	66	I	IL7RA_HUMAN	Disease (T(-)	1494558	B	T	46	I
2	UniProt	VAR_021287	E	113	D	IL7RA_HUMAN	Polymorphism	11567735	B	E	93	D
3	UniProt	VAR_034870	P	132	S	IL7RA_HUMAN	Disease (T(-)	---	B	P	112	S
4	UniProt	VAR_021288	I	138	V	IL7RA_HUMAN	Disease (T(-)	1494555	B	V	118	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021286	T	66	I	IL7RA_HUMAN	Disease (T(-)	1494558	D	T	46	I
2	UniProt	VAR_021287	E	113	D	IL7RA_HUMAN	Polymorphism	11567735	D	E	93	D
3	UniProt	VAR_034870	P	132	S	IL7RA_HUMAN	Disease (T(-)	---	D	P	112	S
4	UniProt	VAR_021288	I	138	V	IL7RA_HUMAN	Disease (T(-)	1494555	D	V	118	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL7RA_HUMAN	131-231	2	B:111-211 D:111-209
2	INTERLEUKIN_7_9	PS00255	Interleukin-7 and -9 signature.	IL7_HUMAN	151-160	2	A:126-135 C:126-135
3	HEMATOPO_REC_S_F1	PS01355	Short hematopoietin receptor family 1 signature.	IL7RA_HUMAN	195-226	2	B:175-206 D:175-206

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL7RA_HUMAN	131-231	1	B:111-211 -
2	INTERLEUKIN_7_9	PS00255	Interleukin-7 and -9 signature.	IL7_HUMAN	151-160	1	A:126-135 -
3	HEMATOPO_REC_S_F1	PS01355	Short hematopoietin receptor family 1 signature.	IL7RA_HUMAN	195-226	1	B:175-206 -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL7RA_HUMAN	131-231	1	- D:111-209
2	INTERLEUKIN_7_9	PS00255	Interleukin-7 and -9 signature.	IL7_HUMAN	151-160	1	- C:126-135
3	HEMATOPO_REC_S_F1	PS01355	Short hematopoietin receptor family 1 signature.	IL7RA_HUMAN	195-226	1	- D:175-206

Asymmetric Unit (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000263851	1a	ENSE00002161613	chr8:79717758-79717148	611	IL7_HUMAN	1-4	4	0	-	-
1.2b	ENST00000263851	2b	ENSE00001757516	chr8:79710443-79710307	137	IL7_HUMAN	4-49	46	2	A:8-24 C:8-24	17 17
1.4	ENST00000263851	4	ENSE00000980755	chr8:79652317-79652237	81	IL7_HUMAN	50-76	27	2	A:25-51 C:25-51	27 27
1.5a	ENST00000263851	5a	ENSE00000794975	chr8:79650870-79650739	132	IL7_HUMAN	77-120	44	2	A:52-91 C:52-90	40 39
1.6	ENST00000263851	6	ENSE00000980756	chr8:79648762-79648709	54	IL7_HUMAN	121-138	18	0	-	-
1.7c	ENST00000263851	7c	ENSE00002096050	chr8:79646067-79645007	1061	IL7_HUMAN	139-177	39	2	A:122-152 C:123-149	31 27

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:115
 aligned with IL7_HUMAN | P13232 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:145
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172     
            IL7_HUMAN    33 DGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH 177
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh............hhhhhhh.....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh------------------------------.....hhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------INTERLEUKI----------------- PROSITE (2)
               Transcript 1 Exon 1.2b        Exon 1.4  PDB: A:25-51     Exon 1.5a  PDB: A:52-91 UniProt: 77-120     Exon 1.6  PDB: -  Exon 1.7c  PDB: A:122-152 [INCOMPLETE]  Transcript 1
                 3di2 A   8 DGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLN------------------------------QKKLNDLCFLKRLLQEIKTCWNKILMGTKEH 152
                                    17        27        37        47        57        67        77        87   |     -         -         -    |  127       137       147     
                                                                                                              91                            122

Chain B from PDB  Type:PROTEIN  Length:195
 aligned with IL7RA_HUMAN | P16871 from UniProtKB/Swiss-Prot  Length:459

    Alignment length:195
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226     
          IL7RA_HUMAN    37 DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEI 231
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------3di2B02 B:109-211 Immunoglobulins                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee..eeeeeeee.........eeeeee.......eee.eee..eeeeee........eeeeeee..eeeeeeee...........eeee..ee....eeeeeeehhhhhh.....eeeeeeeee.......eeeee...eeeee.hhh...eeeeeeeeeee..............eeeee... Sec.struct. author
                 SAPs(SNPs) -----------------------------I----------------------------------------------D------------------S-----V--------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------------------------------------------------------------------------------FN3  PDB: B:111-211 UniProt: 131-231                                                                  PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_S_F1  PDB: B:175-20----- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3di2 B  17 DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEI 211
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206

Chain C from PDB  Type:PROTEIN  Length:110
 aligned with IL7_HUMAN | P13232 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:142
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172  
            IL7_HUMAN    33 DGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGT 174
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh............hhhhhhh.....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh--------------------------------....hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------INTERLEUKI-------------- PROSITE (2)
               Transcript 1 Exon 1.2b        Exon 1.4  PDB: C:25-51     Exon 1.5a  PDB: C:52-90 UniProt: 77-120     Exon 1.6  PDB: -  Exon 1.7c  PDB: C:123-149            Transcript 1
                 3di2 C   8 DGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILL--------------------------------KKLNDLCFLKRLLQEIKTCWNKILMGT 149
                                    17        27        37        47        57        67        77        87  |      -         -         -     | 127       137       147  
                                                                                                             90                              123

Chain D from PDB  Type:PROTEIN  Length:196
 aligned with IL7RA_HUMAN | P16871 from UniProtKB/Swiss-Prot  Length:459

    Alignment length:196
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223      
          IL7RA_HUMAN    34 ELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTP 229
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -----------------------------------------------------------------------------------------------3di2D02 D:109-209 Immunoglobulins                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeeeee..eeeeeeee.........eeeeee.......eee.eee..eeeeee........eeeeeee...eeeeeee...........eeee..ee....eeeeeeehhhhhh.....eeeeeeeee.......eeeee...eeeee.hhh...eeeeee..eee..............eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------I----------------------------------------------D------------------S-----V------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------------------------------------------------------------------------FN3  PDB: D:111-209 UniProt: 131-231                                                                PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_S_F1  PDB: D:175-20--- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3di2 D  14 ELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTP 209
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3DI2)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Human (Homo sapiens) (912)

1a	3di2B02	B:109-211
1b	3di2D02	D:109-209

(no "Pfam Domain" information available for 3DI2)

Asymmetric Unit(hide GO term definitions)

Chain A,C (IL7_HUMAN | P13232)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005126	cytokine receptor binding	Interacting selectively and non-covalently with a cytokine receptor.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0005139	interleukin-7 receptor binding	Interacting selectively and non-covalently with the interleukin-7 receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0002360	T cell lineage commitment	The process in which a lymphoid progenitor cell becomes committed to becoming any type of T cell.
	GO:0009887	animal organ morphogenesis	Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
	GO:0045453	bone resorption	The process in which specialized cells known as osteoclasts degrade the organic and inorganic portions of bone, and endocytose and transport the degradation products.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0048873	homeostasis of number of cells within a tissue	Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
	GO:0006959	humoral immune response	An immune response mediated through a body fluid.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0043086	negative regulation of catalytic activity	Any process that stops or reduces the activity of an enzyme.
	GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
	GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
	GO:0030890	positive regulation of B cell proliferation	Any process that activates or increases the rate or extent of B cell proliferation.
	GO:0045582	positive regulation of T cell differentiation	Any process that activates or increases the frequency, rate or extent of T cell differentiation.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0046622	positive regulation of organ growth	Any process that activates or increases the frequency, rate or extent of growth of an organ of an organism.
	GO:0010468	regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain B,D (IL7RA_HUMAN | P16871)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0004917	interleukin-7 receptor activity	Combining with interleukin-7 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0042100	B cell proliferation	The expansion of a B cell population by cell division. Follows B cell activation.
	GO:0030217	T cell differentiation	The process in which a precursor cell type acquires characteristics of a more mature T-cell. A T cell is a type of lymphocyte whose definin characteristic is the expression of a T cell receptor complex.
	GO:0016049	cell growth	The process in which a cell irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
	GO:0000902	cell morphogenesis	The developmental process in which the size or shape of a cell is generated and organized.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0048872	homeostasis of number of cells	Any biological process involved in the maintenance of the steady-state number of cells within a population of cells.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002377	immunoglobulin production	The appearance of immunoglobulin due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
	GO:0038111	interleukin-7-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-7 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0048535	lymph node development	The process whose specific outcome is the progression of lymph nodes over time, from their formation to the mature structure. A lymph node is a round, oval, or bean shaped structure localized in clusters along the lymphatic vessels, with a distinct internal structure including specialized vasculature and B- and T-zones for the activation of lymphocytes.
	GO:0001915	negative regulation of T cell mediated cytotoxicity	Any process that stops, prevents, or reduces the rate of T cell mediated cytotoxicity.
	GO:0033089	positive regulation of T cell differentiation in thymus	Any process that activates or increases the frequency, rate or extent of T cell differentiation in the thymus.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0000018	regulation of DNA recombination	Any process that modulates the frequency, rate or extent of DNA recombination, a DNA metabolic process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents.
	GO:0008361	regulation of cell size	Any process that modulates the size of a cell.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		1PE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3di2)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3di2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IL7RA_HUMAN \| P16871
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	IL7_HUMAN \| P13232
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	608971
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IL7RA_HUMAN \| P16871
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	IL7_HUMAN \| P13232
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IL7RA_HUMAN \| P16871	:	3di3 3up1 5j11
	IL7_HUMAN \| P13232	:	1il7 3di3

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (10, 10)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

PROSITE Motifs (3, 6)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (46, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File