|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric/Biological Unit (1, 4)
|
Sites (0, 0)| (no "Site" information available for 3BZ6) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3BZ6) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3BZ6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3BZ6) |
Exons (0, 0)| (no "Exon" information available for 3BZ6) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:168 aligned with Y2686_PSESM | Q882E2 from UniProtKB/Swiss-Prot Length:221 Alignment length:168 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 Y2686_PSESM 13 NAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVMNLTQGQVGQSLRALEGRGLTRLVMGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRMHDFEDSEQVVHQLERLIARGLATLVPRQSGQREDRYMHLIGDPEDLQD 180 SCOP domains d3bz6a1 A:13-96 Hypothetical protein PSPTO2686 d3bz6a2 A:97-180 Hypothetical protein PSPTO2686 SCOP domains CATH domains 3bz6A01 A:13-102 'winged helix' repressor DNA binding domain 3bz6A02 A:103-180 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 3bz6 A 13 NAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVmNLTQGQVGQSLRALEGRGLTRLVmGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRmHDFEDSEQVVHQLERLIARGLATLVPRQSGQREDRYmHLIGDPEDLQD 180 22 32 42 52 62 72 82 | 92 102 112 122 132 142 152 162 |172 62-MSE 86-MSE 132-MSE 169-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3BZ6) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Y2686_PSESM | Q882E2)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|