3BGV - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF MRNA CAP GUANINE-N7 METHYLTRANSFERASE IN COMPLEX WITH SAH

Authors :   V. V. Lunin, H. Wu, H. Zeng, T. Antoshenko, F. Mackenzie, J. Weigelt, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, J. Min, A. N. Plotnikov, Structural Genomics Consortium (Sgc)

Date :   27 Nov 07 (Deposition) - 04 Dec 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Methyltransferase, Alternative Splicing, Mrna Capping, Mrna Processing, Nucleus, Phosphoprotein, Rna-Binding, S- Adenosyl-L-Methionine, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Wu, V. V. Lunin, H. Zeng, T. Antoshenko, F. Mackenzie, J. Weigelt, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, J. Min, A. N. Plotnikov
The Crystal Structure Of Human Rna (Guanine-7-) Methyltransferase In Complex With Sah.
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - MRNA CAP GUANINE-N7 METHYLTRANSFERASE
	Chains	:	A, B, C, D
	EC Number	:	2.1.1.56
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET15B
	Expression System Strain	:	DH5A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 165-476
	Gene	:	RNMT, KIAA0398
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MRNA (GUANINE-N(7)-)-METHYLTRANSFERASE, RG7MT1, MRNA CAP METHYLTRANSFERASE, HCM1P, HCMT1, HMET

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	SAH	4	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	SAH	-1	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	SAH	-1	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 3 (1, 4)

No.	Name	Count	Type	Full Name
1	SAH	4	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 4 (0, 0)

No.	Name	Count	Type	Full Name
1	SAH	-1	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:16 , GLY A:41 , GLY A:43 , ASP A:63 , ILE A:64 , ASP A:97 , SER A:98 , GLN A:120 , PHE A:121 , VAL A:122 , TYR A:125 , MET A:136 , HOH A:323 , HOH C:471	BINDING SITE FOR RESIDUE SAH C 313
2	AC2	SOFTWARE	LYS B:16 , GLY B:41 , CYS B:42 , GLY B:43 , ASP B:63 , ILE B:64 , ASP B:97 , SER B:98 , GLN B:120 , PHE B:121 , VAL B:122 , TYR B:125 , HOH B:325 , HOH B:327 , HOH B:330 , HOH C:494 , HOH C:544	BINDING SITE FOR RESIDUE SAH C 314
3	AC3	SOFTWARE	LYS C:16 , GLY C:41 , GLY C:43 , ASP C:63 , ILE C:64 , ASP C:97 , SER C:98 , GLN C:120 , PHE C:121 , VAL C:122 , TYR C:125 , MET C:136 , HOH C:434 , HOH C:439 , HOH C:450 , HOH C:477 , HOH C:519	BINDING SITE FOR RESIDUE SAH C 315
4	AC4	SOFTWARE	HOH C:487 , HOH C:506 , HOH C:526 , LYS D:16 , GLY D:41 , GLY D:43 , ASP D:63 , ILE D:64 , ALA D:96 , ASP D:97 , SER D:98 , GLN D:120 , PHE D:121 , VAL D:122 , TYR D:125 , MET D:136 , HOH D:324 , HOH D:327 , HOH D:341	BINDING SITE FOR RESIDUE SAH C 316

(no "SS Bond" information available for 3BGV)

(no "Cis Peptide Bond" information available for 3BGV)

(no "SAP(SNP)/Variant" information available for 3BGV)

(no "PROSITE Motif" information available for 3BGV)

Asymmetric Unit (9, 36)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000383314	1	ENSE00001313973	chr18:13726660-13726728	69	MCES_HUMAN	-	0	0	-	-
1.2	ENST00000383314	2	ENSE00001540359	chr18:13730626-13730754	129	MCES_HUMAN	-	0	0	-	-
1.3b	ENST00000383314	3b	ENSE00001120461	chr18:13731475-13731933	459	MCES_HUMAN	1-139	139	0	-	-
1.4	ENST00000383314	4	ENSE00000666433	chr18:13734463-13734598	136	MCES_HUMAN	140-185	46	4	A:4-21 B:5-21 C:5-21 D:5-21	18 17 17 17
1.5	ENST00000383314	5	ENSE00000666434	chr18:13737009-13737134	126	MCES_HUMAN	185-227	43	4	A:21-63 (gaps) B:21-63 (gaps) C:21-63 (gaps) D:21-63 (gaps)	43 43 43 43
1.6	ENST00000383314	6	ENSE00000666435	chr18:13740166-13740278	113	MCES_HUMAN	227-264	38	4	A:63-100 (gaps) B:63-100 C:63-100 (gaps) D:63-100 (gaps)	38 38 38 38
1.7	ENST00000383314	7	ENSE00000666436	chr18:13741509-13741690	182	MCES_HUMAN	265-325	61	4	A:101-161 B:101-161 C:101-161 D:101-161	61 61 61 61
1.8	ENST00000383314	8	ENSE00000666437	chr18:13742487-13742651	165	MCES_HUMAN	325-380	56	4	A:161-216 (gaps) B:161-216 (gaps) C:161-216 (gaps) D:161-216 (gaps)	56 56 56 56
1.9	ENST00000383314	9	ENSE00000666438	chr18:13746219-13746336	118	MCES_HUMAN	380-419	40	4	A:216-252 B:216-252 C:216-252 D:216-252	37 37 37 37
1.10	ENST00000383314	10	ENSE00000883621	chr18:13752325-13752426	102	MCES_HUMAN	420-453	34	4	A:287-289 B:286-289 C:286-289 D:286-289	3 4 4 4
1.11	ENST00000383314	11	ENSE00000883622	chr18:13754113-13754146	34	MCES_HUMAN	454-465	12	4	A:290-301 B:290-301 C:290-301 D:290-301	12 12 12 12
1.12b	ENST00000383314	12b	ENSE00001496033	chr18:13759941-13764557	4617	MCES_HUMAN	465-476	12	4	A:301-312 B:301-312 C:301-312 D:301-311	12 12 12 11

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:269
 aligned with MCES_HUMAN | O43148 from UniProtKB/Swiss-Prot  Length:476

    Alignment length:309
                                   177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467         
           MCES_HUMAN   168 RIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ 476
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3bgvA00 A:4-312 Vaccinia Vir  us protein VP39                                                                                                                                                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhh.--..eeeee......hhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhh....-...eeeeee..................eeeeeee.hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhhhh.....eee...eeeee...........eeeeee.---..eee..hhhhhhhhhhhh.eeeeeeeehhhhhhhhh.hhhhhhhhhhhh----------------------------------......hhhhhhhhh.eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4          -----------------------------------------Exon 1.6  PDB: A:63-100 (gaps)        Exon 1.7  PDB: A:101-161 UniProt: 265-325                    ------------------------------------------------------Exon 1.9  PDB: A:216-252 [INCOMPLETE]   Exon 1.10  PDB: A:287-289         Exon 1.11   ----------- Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.5  PDB: A:21-63 (gaps)              -------------------------------------------------------------------------------------------------Exon 1.8  PDB: A:161-216 (gaps) UniProt: 325-380        ------------------------------------------------------------------------------------Exon 1.12b   Transcript 1 (2)
                 3bgv A   4 RIFYLRNFNNWMKSVLIGEFLEKVRQKK--DITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDS-YIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLE---DVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQ----------------------------------LPLGTLSKSEWEATSIYLVFAFEKQQ 312
                                    13        23       | -|       43        53        63        73        83 | |    93       103       113       123       133       143       153       163       173       183       193     | 203       213       223       233       243        |-         -         -         -   |   293       303         
                                                      31 34                                                 85 |                                                                                                             199 203                                              252                                287                         
                                                                                                              87

Chain B from PDB  Type:PROTEIN  Length:271
 aligned with MCES_HUMAN | O43148 from UniProtKB/Swiss-Prot  Length:476

    Alignment length:308
                                   178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468        
           MCES_HUMAN   169 IFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ 476
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3bgvB00 B:5-312 Vaccinia Vi  rus protein VP39                                                                                                                                                                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh..--..eeeee......hhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhh........eeeeee......hhhhh.......eeeeeee.hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhhhhhh...eee...eeeee...........eeeeee.--.eeeee..hhhhhhhhhhhh.eeeeeeeehhhhhhhhh.hhhhhhhhhhhh---------------------------------.......hhhhhhhhh.eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4         -----------------------------------------Exon 1.6  PDB: B:63-100               Exon 1.7  PDB: B:101-161 UniProt: 265-325                    ------------------------------------------------------Exon 1.9  PDB: B:216-252 [INCOMPLETE]   Exon 1.10  PDB: B:286-289         Exon 1.11   ----------- Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.5  PDB: B:21-63 (gaps)              -------------------------------------------------------------------------------------------------Exon 1.8  PDB: B:161-216 (gaps) UniProt: 325-380        ------------------------------------------------------------------------------------Exon 1.12b   Transcript 1 (2)
                 3bgv B   5 IFYLRNFNNWMKSVLIGEFLEKVRQKK--DITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLE--VDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQ---------------------------------RLPLGTLSKSEWEATSIYLVFAFEKQQ 312
                                    14        24      | 34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194    |  204       214       224       234       244       | -         -         -         - |     294       304        
                                                     31 34                                                                                                                                                                  199  |                                               252                               286                          
                                                                                                                                                                                                                               202

Chain C from PDB  Type:PROTEIN  Length:270
 aligned with MCES_HUMAN | O43148 from UniProtKB/Swiss-Prot  Length:476

    Alignment length:308
                                   178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468        
           MCES_HUMAN   169 IFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ 476
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3bgvC00 C:5-312 Vaccinia V  irus protein VP39                                                                                                                                                                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.--...eeeee......hhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhhh...--...eeeeee..................eeeeeee.hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhhhh.....eee...eeeee...........eeeeee...-..eee..hhhhhhhhhhhh.eeeeeeeehhhhhhhhh.hhhhhhhhhhhh---------------------------------.......hhhhhhhhh.eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4         -----------------------------------------Exon 1.6  PDB: C:63-100 (gaps)        Exon 1.7  PDB: C:101-161 UniProt: 265-325                    ------------------------------------------------------Exon 1.9  PDB: C:216-252 [INCOMPLETE]   Exon 1.10  PDB: C:286-289         Exon 1.11   ----------- Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.5  PDB: C:21-63 (gaps)              -------------------------------------------------------------------------------------------------Exon 1.8  PDB: C:161-216 (gaps) UniProt: 325-380        ------------------------------------------------------------------------------------Exon 1.12b   Transcript 1 (2)
                 3bgv C   5 IFYLRNFNNWMKSVLIGEFLEKVRQK--RDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRD--YIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGV-DVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQ---------------------------------RLPLGTLSKSEWEATSIYLVFAFEKQQ 312
                                    14        24     |  34        44        54        64        74        84  |     94       104       114       124       134       144       154       164       174       184       194      |204       214       224       234       244       | -         -         -         - |     294       304        
                                                    30 33                                                 84 87                                                                                                               201 |                                              252                               286                          
                                                                                                                                                                                                                                203

Chain D from PDB  Type:PROTEIN  Length:268
 aligned with MCES_HUMAN | O43148 from UniProtKB/Swiss-Prot  Length:476

    Alignment length:307
                                   178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       
           MCES_HUMAN   169 IFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQ 475
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3bgvD00 D:5-311 Vaccinia V   irus protein VP39                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhh---..eeeee......hhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhh....-...eeeeee......hhhhh.......eeeeeee.hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhhhhh....eee...eeeee...........eeeeee.--....ee..hhhhhhhhhhh..eeeeeeeehhhhhhhhhhhhhhhhhhhhhh---------------------------------.......hhhhhhhhh.eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4         -----------------------------------------Exon 1.6  PDB: D:63-100 (gaps)        Exon 1.7  PDB: D:101-161 UniProt: 265-325                    ------------------------------------------------------Exon 1.9  PDB: D:216-252 [INCOMPLETE]   Exon 1.10  PDB: D:286-289         Exon 1.11   ---------- Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.5  PDB: D:21-63 (gaps)              -------------------------------------------------------------------------------------------------Exon 1.8  PDB: D:161-216 (gaps) UniProt: 325-380        ------------------------------------------------------------------------------------Exon 1.12b  Transcript 1 (2)
                 3bgv D   5 IFYLRNFNNWMKSVLIGEFLEKVRQK---DITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDS-YIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLE--VDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQ---------------------------------RLPLGTLSKSEWEATSIYLVFAFEKQ 311
                                    14        24     |  34        44        54        64        74        84| |     94       104       114       124       134       144       154       164       174       184       194    |  204       214       224       234       244       | -         -         -         - |     294       304       
                                                    30  34                                                 85 |                                                                                                             199  |                                               252                               286                         
                                                                                                             87                                                                                                                202

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3BGV)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Vaccinia Virus protein VP39 (378)

Human (Homo sapiens) (49)

1a	3bgvD00	D:5-311
1b	3bgvA00	A:4-312
1c	3bgvC00	C:5-312
1d	3bgvB00	B:5-312

(no "Pfam Domain" information available for 3BGV)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (MCES_HUMAN | O43148)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0004482	mRNA (guanine-N7-)-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine + G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppR-RNA. m7G(5')pppR-RNA is mRNA containing an N7-methylguanine cap; R may be guanosine or adenosine.
	GO:0008168	methyltransferase activity	Catalysis of the transfer of a methyl group to an acceptor molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006370	7-methylguanosine mRNA capping	Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
	GO:0036265	RNA (guanine-N7)-methylation	The addition of a methyl group to the N7 atom in the base portion of a guanine nucleotide residue in an RNA molecule.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0032259	methylation	The process in which a methyl group is covalently attached to a molecule.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
cellular component
	GO:0005845	mRNA cap binding complex	Any protein complex that binds to an mRNA cap at any time in the lifetime of the mRNA.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SAH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3bgv)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3bgv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MCES_HUMAN \| O43148
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.1.56
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MCES_HUMAN \| O43148
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MCES_HUMAN \| O43148	:	3epp 5e8j 5e9j 5e9w

(no "Related Entries Specified in the PDB File" available for 3BGV)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (9, 36)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File