Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF PREVOTELLA INTERMEDIA PROINTERPAIN A FRAGMENT 39-359 (MUTANT C154A)
 
Authors :  N. Mallorqui-Fernandez, S. P. Manandhar, G. Mallorqui-Fernandez, I. K. Wawrzonek, T. Kantyka, M. Sola, I. B. Thogersen, J. J. Enghild, J. Po F. X. Gomis-Ruth
Date :  09 Nov 07  (Deposition) - 20 Nov 07  (Release) - 18 May 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Cysteine Protease, Zymogen Activation, Bacterial Odontopathogen, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. Mallorqui-Fernandez, S. P. Manandhar, G. Mallorqui-Fernandez, I. Uson, K. Wawrzonek, T. Kantyka, M. Sola, I. B. Thogersen, J. J. Enghild, J. Potempa, F. X. Gomis-Ruth
A New Autocatalytic Activation Mechanism For Cysteine Proteases Revealed By Prevotella Intermedia Interpain A
J. Biol. Chem. V. 283 2871 2008
PubMed-ID: 17993455  |  Reference-DOI: 10.1074/JBC.M708481200

(-) Compounds

Molecule 1 - INTERPAIN A
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET24D(+)
    Expression System Strain: BL21(DE3) PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 84-403
    Gene: PIN0048
    Mutation: YES
    Organism Scientific: PREVOTELLA INTERMEDIA
    Organism Taxid: 28131

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3BB7)

(-) Sites  (0, 0)

(no "Site" information available for 3BB7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BB7)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Met A:136 -Pro A:137
2Tyr A:168 -Pro A:169
3Tyr A:180 -Pro A:181

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3BB7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3BB7)

(-) Exons   (0, 0)

(no "Exon" information available for 3BB7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:314
 aligned with A9J7N5_PREIN | A9J7N5 from UniProtKB/TrEMBL  Length:868

    Alignment length:321
                                    92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402 
         A9J7N5_PREIN    83 VNQLRELKQTHTYTVFGYTDGGFAVISADDLAPELLGVSESNFVETDNPSFKWWLKAIDEVITNAVKNNKPLSVIKPDPSKYAAEVSTLLTTTWGQQMPYNKLLPNTKKGRLITGCVATATAQALNYFKYPVRGIGSHTVHYPANDPSGVAISADFGNTTYDWANMKDDYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTYFGFTDAEYITRADYTDEQWMDIVFSELTKGHPLIYGGVSPGSMGQDAGHAFVIDGYNKAGLVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYGKP 403
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....eeeee....eeee........eeeee........hhhhhhhhhhhhhhhhhhhhhh.............................................hhhhhhhhhhhhhhh........eeeee.......eeeeehhhhh..hhhhh........hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhh.....eeee.hhhhhhhhhhhhhhhhhh...eeeee.-------...eeeeeeee.....eeee........eee.................eeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3bb7 A  39 ANQLRELKQTHTYTVFGYTDGGFAVISADDLAPELLGVSESNFVETDNPSFKWWLKAIDEVITNAVKSNKPLNVIKPDPSKYAAEVSTLLTTTWGQQMPYNKLLPKTKKGRLITGAVATATAQVLNYFKYPVRGIGSHTVHYPANDPSGVAISADFGNTTYDWANMKDNYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTYFGFTDAEYITRANYTDEQWMDIVFSELTKGHPLIYGGV-------DAGHAFVIDGYNKAGLVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYGKP 359
                                    48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288     |   -   |   308       318       328       338       348       358 
                                                                                                                                                                                                                                                                                         294     302
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3BB7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3BB7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BB7)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (A9J7N5_PREIN | A9J7N5)
molecular function
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3bb7)
 
  Sites
(no "Sites" information available for 3bb7)
 
  Cis Peptide Bonds
    Met A:136 - Pro A:137   [ RasMol ]  
    Tyr A:168 - Pro A:169   [ RasMol ]  
    Tyr A:180 - Pro A:181   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3bb7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9J7N5_PREIN | A9J7N5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A9J7N5_PREIN | A9J7N5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A9J7N5_PREIN | A9J7N5: 3bba

(-) Related Entries Specified in the PDB File

3bba ACTIVE WILD-TYPE OF THE SAME PROTEIN