|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric Unit (1, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3AO9) |
Cis Peptide Bonds (3, 3)
Asymmetric Unit
|
||||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3AO9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3AO9) |
Exons (0, 0)| (no "Exon" information available for 3AO9) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:97 aligned with CEA5_ECOLX | P18000 from UniProtKB/Swiss-Prot Length:180 Alignment length:97 90 100 110 120 130 140 150 160 170 CEA5_ECOLX 81 IPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNK 177 SCOP domains d3ao9a_ A: Colicin E5 SCOP domains CATH domains ------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 3ao9 A 17 IPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNK 113 26 36 46 56 66 76 86 96 106 Chain B from PDB Type:PROTEIN Length:86 aligned with CEA5_ECOLX | P18000 from UniProtKB/Swiss-Prot Length:180 Alignment length:96 92 102 112 122 132 142 152 162 172 CEA5_ECOLX 83 GLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKN 178 SCOP domains d3ao9b_ B: Colicin E5 SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 3ao9 B 19 GLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRS----------RNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKN 114 28 38 48 |- 68 78 88 98 108 57 68
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3AO9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3AO9) |
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A,B (CEA5_ECOLX | P18000)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|