|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2DFX) |
Sites (0, 0)| (no "Site" information available for 2DFX) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2DFX) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2DFX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2DFX) |
Exons (0, 0)| (no "Exon" information available for 2DFX) |
Sequences/Alignments
Asymmetric/Biological UnitChain E from PDB Type:PROTEIN Length:92 aligned with CEA5_ECOLX | P18000 from UniProtKB/Swiss-Prot Length:180 Alignment length:92 93 103 113 123 133 143 153 163 173 CEA5_ECOLX 84 LKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWG 175 SCOP domains d2dfxe_ E: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 2dfx E 20 LKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWG 111 29 39 49 59 69 79 89 99 109 Chain I from PDB Type:PROTEIN Length:106 aligned with IMM5_ECOLX | P13476 from UniProtKB/Swiss-Prot Length:83 Alignment length:106 1 - - | 7 17 27 37 47 57 67 77 IMM5_ECOLX - -----------------------MKLSPKAAIEVCNEAAKKGLWILGIDGGHWLNPGFRIDSSASWTYDMPEEYKSKIPENNRLAIENIKDDIENGYTAFIITLKM 83 SCOP domains -----------------------d2dfxi1 I:26-108 Colicin E5 immunity protein ImmE5 SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 2dfx I 3 KLFEHTVLYDSGDAFFELKGNASMKLSPKAAIEVCNEAAKKGLWILGIDGGHWLNPGFRIDSSASWTYDMPEEYKSKIPENNRLAIENIKDDIENGYTAFIITLKM 108 12 22 32 42 52 62 72 82 92 102
|
||||||||||||||||||||
SCOP Domains (2, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2DFX) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2DFX) |
Gene Ontology (9, 9)|
Asymmetric/Biological Unit(hide GO term definitions) Chain E (CEA5_ECOLX | P18000)
Chain I (IMM5_ECOLX | P13476)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|