![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3A5U) |
(no "Site" information available for 3A5U) |
(no "SS Bond" information available for 3A5U) |
(no "Cis Peptide Bond" information available for 3A5U) |
(no "SAP(SNP)/Variant" information available for 3A5U) |
Asymmetric Unit (1, 2) Biological Unit 1 (1, 4) |
(no "Exon" information available for 3A5U) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:118 aligned with SSB_MYCS2 | Q9AFI5 from UniProtKB/Swiss-Prot Length:165 Alignment length:119 10 20 30 40 50 60 70 80 90 100 110 SSB_MYCS2 1 MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNK 119 SCOP domains d3a5ua_ A: automated matches SCOP domains CATH domains 3a5uA00 A:1-119 Nucleic acid-binding proteins CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE SSB PDB: A:1-110 UniProt: 1-110 --------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 3a5u A 1 MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSF-TREGEKRTVVEVEVDEIGPSLRYATAKVNK 119 10 20 30 40 50 60 70 80 |90 100 110 88 | 90 Chain B from PDB Type:PROTEIN Length:112 aligned with SSB_MYCS2 | Q9AFI5 from UniProtKB/Swiss-Prot Length:165 Alignment length:119 10 20 30 40 50 60 70 80 90 100 110 SSB_MYCS2 1 MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNK 119 SCOP domains d3a5ub_ B: automated matches SCOP domains CATH domains 3a5uB00 B:1-119 Nucleic acid-binding pr oteins CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE SSB PDB: B:1-110 UniProt: 1-110 --------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 3a5u B 1 MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRM-----GEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETRE--KRTVVEVEVDEIGPSLRYATAKVNK 119 10 20 30 |- | 50 60 70 80 90 | | 100 110 39 45 92 95 Chain C from PDB Type:DNA Length:31 3a5u C 1 CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 31 10 20 30
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 3A5U) |
Asymmetric Unit(hide GO term definitions) Chain A,B (SSB_MYCS2 | Q9AFI5)
|
|
|
|
|
|
|