3ZFX - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Biological Unit 7 (Jmol Viewer)

Biological Unit 8 (Jmol Viewer)

Biological Unit 9 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF EPHB1

Authors :   J. E. Debreczeni, R. Overman, C. Truman, M. Mcalister, T. K. Attwood

Date :   12 Dec 12 (Deposition) - 08 Jan 14 (Release) - 07 May 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,I
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: E  (1x)
Biol. Unit 6: F  (1x)
Biol. Unit 7: G  (1x)
Biol. Unit 8: H  (1x)
Biol. Unit 9: I  (1x)

Keywords :   Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. C. Overman, J. E. Debreczeni, C. M. Truman, M. S. Mcalister, T. K. Attwood
Completing The Structural Family Portrait Of The Human Ephb Tyrosine Kinase Domains
Protein Sci. V. 23 627 2014
PubMed-ID: 24677421 | Reference-DOI: 10.1002/PRO.2445

Molecule 1 - EPHRIN TYPE-B RECEPTOR 1
	Chains	:	A, B, C, D, E, F, G, H, I
	EC Number	:	2.7.10.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Variant	:	STAR
	Expression System Vector	:	PLASMID
	Fragment	:	KINASE DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	2.7.10.1, ELK, EPH TYROSINE KINASE 2, EPH-LIKE KINASE 6, EK6, HEK6, NEURONALLY-EXPRESSED EPH-RELATED TYROSINE KINASE, NET, TYROSINE-PROTEIN KINASE RECEPTOR EPH-2, EPHB1

		1	2	3	4	5	6	7	8	9
Asymmetric Unit	:	A	B	C	D	E	F	G	H	I
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:					E
Biological Unit 6 (1x)	:						F
Biological Unit 7 (1x)	:							G
Biological Unit 8 (1x)	:								H
Biological Unit 9 (1x)	:									I

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 3 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 4 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 5 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 6 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 7 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 8 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 9 (0, 0)

No.	Name	Count	Type	Full Name
1	SO4	-1	Ligand/Ion	SULFATE ION

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:726 , ALA A:730 , LYS A:733	BINDING SITE FOR RESIDUE SO4 A1890

(no "SS Bond" information available for 3ZFX)

Asymmetric Unit

No.	Residues
1	Arg A:691	-	Pro A:692
2	Arg B:691	-	Pro B:692
3	Arg C:691	-	Pro C:692
4	Arg D:691	-	Pro D:692
5	Arg E:691	-	Pro E:692
6	Arg F:691	-	Pro F:692
7	Arg G:691	-	Pro G:692
8	Arg H:691	-	Pro H:692
9	Arg I:691	-	Pro I:692

Asymmetric Unit (4, 36)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	A/B/C/D/E/F/G/H/I	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	A/B/C/D/E/F/G/H/I	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	A/B/C/D/E/F/G/H/I	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	A/B/C/D/E/F/G/H/I	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	A	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	A	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	A	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	A	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	B	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	B	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	B	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	B	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	C	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	C	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	C	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	C	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	D	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	D	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	D	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	D	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	E	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	E	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	E	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	E	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	F	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	F	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	F	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	F	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 7 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	G	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	G	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	G	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	G	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 8 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	H	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	H	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	H	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	H	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 9 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042167	S	707	T	EPHB1_HUMAN	Unclassified	---	I	S	707	T
2	UniProt	VAR_042168	I	719	V	EPHB1_HUMAN	Unclassified	---	I	I	719	V
3	UniProt	VAR_042169	R	743	Q	EPHB1_HUMAN	Unclassified	---	I	R	743	Q
4	UniProt	VAR_011805	M	847	T	EPHB1_HUMAN	Polymorphism	1042785	I	M	847	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 18)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	9	A:625-651 B:625-651 C:625-651 D:625-651 E:625-651 F:625-651 G:625-651 H:625-651 I:625-651
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	9	A:740-752 B:740-752 C:740-752 D:740-752 E:740-752 F:740-752 G:740-752 H:740-752 I:740-752

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	A:625-651 - - - - - - - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	A:740-752 - - - - - - - -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- B:625-651 - - - - - - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- B:740-752 - - - - - - -

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- - C:625-651 - - - - - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- - C:740-752 - - - - - -

Biological Unit 4 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- - - D:625-651 - - - - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- - - D:740-752 - - - - -

Biological Unit 5 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- - - - E:625-651 - - - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- - - - E:740-752 - - - -

Biological Unit 6 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- - - - - F:625-651 - - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- - - - - F:740-752 - - -

Biological Unit 7 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- - - - - - G:625-651 - -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- - - - - - G:740-752 - -

Biological Unit 8 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- - - - - - - H:625-651 -
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- - - - - - - H:740-752 -

Biological Unit 9 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	EPHB1_HUMAN	625-651	1	- - - - - - - - I:625-651
2	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	EPHB1_HUMAN	740-752	1	- - - - - - - - I:740-752

Asymmetric Unit (5, 45)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.7a	ENST00000398015	7a	ENSE00001930517	chr3:134514104-134514531	428	EPHB1_HUMAN	1-20	20	0	-	-
1.13	ENST00000398015	13	ENSE00001303670	chr3:134644658-134644722	65	EPHB1_HUMAN	20-41	22	0	-	-
1.14f	ENST00000398015	14f	ENSE00001329897	chr3:134670213-134670894	682	EPHB1_HUMAN	42-269	228	0	-	-
1.17	ENST00000398015	17	ENSE00001767599	chr3:134825290-134825445	156	EPHB1_HUMAN	269-321	53	0	-	-
1.18c	ENST00000398015	18c	ENSE00001645608	chr3:134851556-134851891	336	EPHB1_HUMAN	321-433	113	0	-	-
1.19a	ENST00000398015	19a	ENSE00001723961	chr3:134872994-134873118	125	EPHB1_HUMAN	433-474	42	0	-	-
1.20	ENST00000398015	20	ENSE00001701123	chr3:134880860-134881022	163	EPHB1_HUMAN	475-529	55	0	-	-
1.21	ENST00000398015	21	ENSE00001728529	chr3:134884810-134884918	109	EPHB1_HUMAN	529-565	37	0	-	-
1.22	ENST00000398015	22	ENSE00001618327	chr3:134885784-134885848	65	EPHB1_HUMAN	565-587	23	0	-	-
1.23	ENST00000398015	23	ENSE00001719384	chr3:134898702-134898824	123	EPHB1_HUMAN	587-628	42	9	A:611-627 B:611-627 C:614-627 D:611-627 E:611-627 F:612-627 G:611-627 H:611-627 I:611-627	17 17 14 17 17 16 17 17 17
1.24b	ENST00000398015	24b	ENSE00001648910	chr3:134911418-134911665	248	EPHB1_HUMAN	628-710	83	9	A:630-710 (gaps) B:631-710 (gaps) C:631-710 (gaps) D:630-710 (gaps) E:631-710 (gaps) F:631-710 (gaps) G:631-710 (gaps) H:629-710 (gaps) I:629-710 (gaps)	81 80 80 81 80 80 80 82 82
1.25	ENST00000398015	25	ENSE00001639353	chr3:134920316-134920531	216	EPHB1_HUMAN	711-782	72	9	A:711-770 B:711-769 C:711-767 D:711-770 E:711-769 F:711-769 G:711-769 H:711-769 I:711-769	60 59 57 60 59 59 59 59 59
1.26	ENST00000398015	26	ENSE00001597838	chr3:134959990-134960139	150	EPHB1_HUMAN	783-832	50	9	A:784-832 B:788-832 C:787-832 D:784-832 E:784-832 F:788-832 G:788-832 H:784-832 I:784-832	49 45 46 49 49 45 45 49 49
1.27	ENST00000398015	27	ENSE00001792565	chr3:134967158-134967351	194	EPHB1_HUMAN	833-897	65	9	A:833-893 B:833-892 C:833-892 D:833-893 E:833-893 F:833-893 G:833-892 H:833-892 I:833-891	61 60 60 61 61 61 60 60 59
1.28	ENST00000398015	28	ENSE00001692283	chr3:134968178-134968333	156	EPHB1_HUMAN	897-949	53	0	-	-
1.29c	ENST00000398015	29c	ENSE00001855733	chr3:134977854-134979309	1456	EPHB1_HUMAN	949-984	36	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:267
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:283
                                   620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890   
          EPHB1_HUMAN   611 AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
               SCOP domains d3zfxa_ A: automa  ted matches                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeeeee.--...eeeeee.......eeeeeee....-hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..-------------........hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T---------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23         ----------------------------------------------------------------------------------Exon 1.25  PDB: A:711-770 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: A:784-832 UniProt: 783-832        Exon 1.27  PDB: A:833-893 UniProt: 833-897 [INCOMPLETE]       Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.24b  PDB: A:630-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx A 611 AKEIDVSFVKIEEVIGA--FGEVYKGRLKLPGKREIYVAIKTLKAG-SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ-------------GKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
                                   620      |630       640       650     | 660       670       680       690       700       710       720       730       740       750       760       770         -   |   790       800       810       820       830       840       850       860       870       880       890   
                                          627  |                       656 |                                                                                                             770           784                                                                                                             
                                             630                         658

Chain B from PDB  Type:PROTEIN  Length:254
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:282
                                   620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890  
          EPHB1_HUMAN   611 AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
               SCOP domains d3zfxb_ B: automa   ted match    es                                                                                                                                                                                                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhh.eeeeeeee.---..eeeeee.----..eeeeeee..---hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee.hhhhhee.------------------....hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T--------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23         ----------------------------------------------------------------------------------Exon 1.25  PDB: B:711-769 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: B:788-832 UniProt: 783-832        Exon 1.27  PDB: B:833-892 UniProt: 833-897 [INCOMPLETE]      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.24b  PDB: B:631-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx B 611 AKEIDVSFVKIEEVIGA---GEVYKGRLK----REIYVAIKTLK---SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYL------------------VRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
                                   620      |  -|       |-   |   650   |   660       670       680       690       700       710       720       730       740       750       760        |-         -       790       800       810       820       830       840       850       860       870       880       890  
                                          627 631     639  644       654 658                                                                                                            769                788

Chain C from PDB  Type:PROTEIN  Length:248
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:279
                                   623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883         
          EPHB1_HUMAN   614 IDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
               SCOP domains d3zfxc_ C: aut   omated       matches                                                                                                                                                                                                                                                   SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhheeeeeee.---..eeeee------....eeeee..---hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.hhhhh.-------------------.....hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T--------------------------------------------- SAPs(SNPs)
                    PROSITE -----------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23      ----------------------------------------------------------------------------------Exon 1.25  PDB: C:711-767 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: C:787-832 UniProt: 783-832        Exon 1.27  PDB: C:833-892 UniProt: 833-897 [INCOMPLETE]      Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.24b  PDB: C:631-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx C 614 IDVSFVKIEEVIGA---GEVYKGR------REIYVAIKTLK---SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSR-------------------PVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
                                   623   |   633   |     -|      653|   |  663       673       683       693       703       713       723       733       743       753       763   |     -         -   |   793       803       813       823       833       843       853       863       873       883         
                                       627 631   637    644       654 658                                                                                                          767                 787

Chain D from PDB  Type:PROTEIN  Length:265
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:283
                                   620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890   
          EPHB1_HUMAN   611 AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
               SCOP domains d3zfxd_ D: automa  ted matches                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeeeee.--...eeeeee..--...eeeeeee....-hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..-------------........hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T---------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23         ----------------------------------------------------------------------------------Exon 1.25  PDB: D:711-770 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: D:784-832 UniProt: 783-832        Exon 1.27  PDB: D:833-893 UniProt: 833-897 [INCOMPLETE]       Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.24b  PDB: D:630-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx D 611 AKEIDVSFVKIEEVIGA--FGEVYKGRLKL--KREIYVAIKTLKAG-SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ-------------GKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
                                   620      |630       640  |    650     | 660       670       680       690       700       710       720       730       740       750       760       770         -   |   790       800       810       820       830       840       850       860       870       880       890   
                                          627  |       640  |          656 |                                                                                                             770           784                                                                                                             
                                             630          643            658

Chain E from PDB  Type:PROTEIN  Length:262
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:283
                                   620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890   
          EPHB1_HUMAN   611 AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
               SCOP domains d3zfxe_ E: automa   ted matche  s                                                                                                                                                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeeeee.---..eeeeeee.--..eeeeeeee...--hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.--------------........hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T---------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23         ----------------------------------------------------------------------------------Exon 1.25  PDB: E:711-769 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: E:784-832 UniProt: 783-832        Exon 1.27  PDB: E:833-893 UniProt: 833-897 [INCOMPLETE]       Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.24b  PDB: E:631-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx E 611 AKEIDVSFVKIEEVIGA---GEVYKGRLKL--KREIYVAIKTLKA--SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYL--------------GKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
                                   620      |  -|      640  |    650    |  660       670       680       690       700       710       720       730       740       750       760        |-         -   |   790       800       810       820       830       840       850       860       870       880       890   
                                          627 631      640  |         655  |                                                                                                            769            784                                                                                                             
                                                          643            658

Chain F from PDB  Type:PROTEIN  Length:254
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:282
                                   621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891  
          EPHB1_HUMAN   612 KEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
               SCOP domains d3zfxf_ F: autom   ated matc     hes                                                                                                                                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhh.eeeeeeee.---..eeeeee.-----.eeeeeeee..--hhhhhhhhhhhhhhhh.........eeeee.....eeeeee....eehhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.------------------....hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23        ----------------------------------------------------------------------------------Exon 1.25  PDB: F:711-769 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: F:788-832 UniProt: 783-832        Exon 1.27  PDB: F:833-893 UniProt: 833-897 [INCOMPLETE]       Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.24b  PDB: F:631-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx F 612 KEIDVSFVKIEEVIGA---GEVYKGRLK-----EIYVAIKTLKA--SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYL------------------VRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT 893
                                   621     | 631       | -   |   651   |  |661       671       681       691       701       711       721       731       741       751       761       | -         -      |791       801       811       821       831       841       851       861       871       881       891  
                                         627 631     639   645       655  |                                                                                                            769                788                                                                                                         
                                                                        658

Chain G from PDB  Type:PROTEIN  Length:253
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:282
                                   620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890  
          EPHB1_HUMAN   611 AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
               SCOP domains d3zfxg_ G: automa   ted match     es                                                                                                                                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhh.eeeeeeee.---..eeeeee.-----.eeeeeee..---hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.------------------....hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T--------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23         ----------------------------------------------------------------------------------Exon 1.25  PDB: G:711-769 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: G:788-832 UniProt: 783-832        Exon 1.27  PDB: G:833-892 UniProt: 833-897 [INCOMPLETE]      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.24b  PDB: G:631-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx G 611 AKEIDVSFVKIEEVIGA---GEVYKGRLK-----EIYVAIKTLK---SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYL------------------VRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
                                   620      |  -|       |-    |  650   |   660       670       680       690       700       710       720       730       740       750       760        |-         -       790       800       810       820       830       840       850       860       870       880       890  
                                          627 631     639   645      654 658                                                                                                            769                788

Chain H from PDB  Type:PROTEIN  Length:266
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:282
                                   620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890  
          EPHB1_HUMAN   611 AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
               SCOP domains d3zfxh_ H: automa ted matches                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhh.eeeeeeee.-....eeeeee.......eeeeeee....-hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.--------------........hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T--------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23         ----------------------------------------------------------------------------------Exon 1.25  PDB: H:711-769 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: H:784-832 UniProt: 783-832        Exon 1.27  PDB: H:833-892 UniProt: 833-897 [INCOMPLETE]      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.24b  PDB: H:629-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx H 611 AKEIDVSFVKIEEVIGA-EFGEVYKGRLKLPGKREIYVAIKTLKAG-SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYL--------------GKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVA 892
                                   620      |630       640       650     | 660       670       680       690       700       710       720       730       740       750       760        |-         -   |   790       800       810       820       830       840       850       860       870       880       890  
                                          627 |                        656 |                                                                                                            769            784                                                                                                            
                                            629                          658

Chain I from PDB  Type:PROTEIN  Length:263
 aligned with EPHB1_HUMAN | P54762 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:281
                                   620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890 
          EPHB1_HUMAN   611 AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTV 891
               SCOP domains d3zfxi_ I: automa ted matches                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeeeee.-....eeeeee.......eeeeeeee.---hhhhhhhhhhhhhhhh.........eeeee.....eeeeee....eehhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.--------------........hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------T-----------V-----------------------Q-------------------------------------------------------------------------------------------------------T-------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP         ----------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.23         ----------------------------------------------------------------------------------Exon 1.25  PDB: I:711-769 UniProt: 711-782 [INCOMPLETE]                 Exon 1.26  PDB: I:784-832 UniProt: 783-832        Exon 1.27  PDB: I:833-891 UniProt: 833-897 [INCOMPLETE]     Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.24b  PDB: I:629-710 (gaps) UniProt: 628-710 [INCOMPLETE]                    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3zfx I 611 AKEIDVSFVKIEEVIGA-EFGEVYKGRLKLPGKREIYVAIKTLK---SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYL--------------GKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTV 891
                                   620      |630       640       650   |   660       670       680       690       700       710       720       730       740       750       760        |-         -   |   790       800       810       820       830       840       850       860       870       880       890 
                                          627 |                      654 658                                                                                                            769            784                                                                                                           
                                            629

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Protein kinase-like (PK-like) (2589)

Superfamily: Protein kinase-like (PK-like) (2589)

Family: automated matches (529)

Protein domain: automated matches (529)

Human (Homo sapiens) [TaxId: 9606] (438)

1a	d3zfxa_	A:
1b	d3zfxb_	B:
1c	d3zfxc_	C:
1d	d3zfxd_	D:
1e	d3zfxe_	E:
1f	d3zfxf_	F:
1g	d3zfxg_	G:
1h	d3zfxh_	H:
1i	d3zfxi_	I:

(no "CATH Domain" information available for 3ZFX)

(no "Pfam Domain" information available for 3ZFX)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H,I (EPHB1_HUMAN | P54762)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0008046	axon guidance receptor activity	Combining with an extracellular messenger and transmitting the signal from one side of the membrane to the other to results in a change in cellular activity involved in axon guidance.
	GO:0005003	ephrin receptor activity	Combining with an ephrin to initiate a change in cell activity.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004714	transmembrane receptor protein tyrosine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
	GO:0005005	transmembrane-ephrin receptor activity	Combining with a transmembrane ephrin to initiate a change in cell activity.
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0048593	camera-type eye morphogenesis	The process in which the anatomical structures of the eye are generated and organized. The camera-type eye is an organ of sight that receives light through an aperture and focuses it through a lens, projecting it on a photoreceptor field.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0060326	cell chemotaxis	The directed movement of a motile cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0031589	cell-substrate adhesion	The attachment of a cell to the underlying substrate via adhesion molecules.
	GO:0021952	central nervous system projection neuron axonogenesis	Generation of a long process of a CNS neuron, that carries efferent (outgoing) action potentials from the cell body towards target cells in a different central nervous system region.
	GO:0021545	cranial nerve development	The process whose specific outcome is the progression of the cranial nerves over time, from its formation to the mature structure. The cranial nerves are composed of twelve pairs of nerves that emanate from the nervous tissue of the hindbrain. These nerves are sensory, motor, or mixed in nature, and provide the motor and general sensory innervation of the head, neck and viscera. They mediate vision, hearing, olfaction and taste and carry the parasympathetic innervation of the autonomic ganglia that control visceral functions.
	GO:0060996	dendritic spine development	The process whose specific outcome is the progression of the dendritic spine over time, from its formation to the mature structure. A dendritic spine is a protrusion from a dendrite and a specialized subcellular compartment involved in synaptic transmission.
	GO:0060997	dendritic spine morphogenesis	The process in which the anatomical structures of a dendritic spine are generated and organized. A dendritic spine is a protrusion from a dendrite and a specialized subcellular compartment involved in synaptic transmission.
	GO:0050965	detection of temperature stimulus involved in sensory perception of pain	The series of events involved in the perception of pain in which a temperature stimulus is received and converted into a molecular signal.
	GO:0048013	ephrin receptor signaling pathway	The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
	GO:0030010	establishment of cell polarity	The specification and formation of anisotropic intracellular organization or cell growth patterns.
	GO:0001771	immunological synapse formation	The formation of an area of close contact between a lymphocyte (T-, B-, or natural killer cell) and a target cell through the clustering of particular signaling and adhesion molecules and their associated membrane rafts on both the lymphocyte and target cell, which facilitates activation of the lymphocyte, transfer of membrane from the target cell to the lymphocyte, and in some situations killing of the target cell through release of secretory granules and/or death-pathway ligand-receptor interaction.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0061351	neural precursor cell proliferation	The multiplication or reproduction of neural precursor cells, resulting in the expansion of a cell population. A neural precursor cell is either a nervous system stem cell or a nervous system progenitor cell.
	GO:0022008	neurogenesis	Generation of cells within the nervous system.
	GO:0021631	optic nerve morphogenesis	The process in which the anatomical structure of the optic nerve is generated and organized. The sensory optic nerve originates from the bipolar cells of the retina and conducts visual information to the brainstem. The optic nerve exits the back of the eye in the orbit, enters the optic canal, and enters the central nervous system at the optic chiasm (crossing) where the nerve fibers become the optic tract just prior to entering the hindbrain.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0051965	positive regulation of synapse assembly	Any process that activates, maintains or increases the frequency, rate or extent of synapse assembly, the aggregation, arrangement and bonding together of a set of components to form a synapse.
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0070372	regulation of ERK1 and ERK2 cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0046328	regulation of JNK cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the JNK cascade.
	GO:1901214	regulation of neuron death	Any process that modulates the frequency, rate or extent of neuron death.
	GO:0031290	retinal ganglion cell axon guidance	The process in which the migration of an axon growth cone of a retinal ganglion cell (RGC) is directed to its target in the brain in response to a combination of attractive and repulsive cues.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0032433	filopodium tip	The end of a filopodium distal to the body of the cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:691 - Pro A:692	[ RasMol ]
		Arg B:691 - Pro B:692	[ RasMol ]
		Arg C:691 - Pro C:692	[ RasMol ]
		Arg D:691 - Pro D:692	[ RasMol ]
		Arg E:691 - Pro E:692	[ RasMol ]
		Arg F:691 - Pro F:692	[ RasMol ]
		Arg G:691 - Pro G:692	[ RasMol ]
		Arg H:691 - Pro H:692	[ RasMol ]
		Arg I:691 - Pro I:692	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]
		Biological Unit 7	[ Jena3D ]
		Biological Unit 8	[ Jena3D ]
		Biological Unit 9	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format \| Biol. Unit 7 PNG format \| Biol. Unit 8 PNG format \| Biol. Unit 9 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3zfx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EPHB1_HUMAN \| P54762
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	EPHB1_HUMAN \| P54762
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	EPHB1_HUMAN \| P54762	:	2djs 2eao 5mja 5mjb

3zew	CRYSTAL STRUCTURE OF EPHB4 IN COMPLEX WITH STAUROSPORINE
3zfm	CRYSTAL STRUCTURE OF EPHB2
3zfy	CRYSTAL STRUCTURE OF EPHB3

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (9, 9)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 36)

PROSITE Motifs (2, 18)

Exons (5, 45)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 9)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (55, 55)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File