3VPA - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   STAPHYLOCOCCUS AUREUS FTSZ APO-FORM

Authors :   T. Matsui, J. Yamane, N. Mogi, M. Yao, I. Tanaka

Date :   28 Feb 12 (Deposition) - 29 Aug 12 (Release) - 14 Aug 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.49

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Ftsz, Gtp-Binding, Tubulin Homolog, Polymerization, Gtpase, Cell Division, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Matsui, J. Yamane, N. Mogi, H. Yamaguchi, H. Takemoto, M. Yao, I. Tanaka
Structural Reorganization Of The Bacterial Cell-Division Protein Ftsz From Staphylococcus Aureus
Acta Crystallogr. , Sect. D V. 68 1175 2012
PubMed-ID: 22948918 | Reference-DOI: 10.1107/S0907444912022640

Molecule 1 - CELL DIVISION PROTEIN FTSZ
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 12-316
	Gene	:	FTSZ
	Organism Scientific	:	STAPHYLOCOCCUS AUREUS
	Organism Taxid	:	158878
	Strain	:	MU50

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3VPA)

(no "Site" information available for 3VPA)

(no "SS Bond" information available for 3VPA)

(no "Cis Peptide Bond" information available for 3VPA)

(no "SAP(SNP)/Variant" information available for 3VPA)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FTSZ_1	PS01134	FtsZ protein signature 1.	FTSZ_STAAM	44-78	4	A:44-78 B:44-78 C:44-78 D:44-78
2	FTSZ_2	PS01135	FtsZ protein signature 2.	FTSZ_STAAM	97-118	4	A:97-118 B:97-118 C:97-118 D:97-118

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FTSZ_1	PS01134	FtsZ protein signature 1.	FTSZ_STAAM	44-78	1	A:44-78 - - -
2	FTSZ_2	PS01135	FtsZ protein signature 2.	FTSZ_STAAM	97-118	1	A:97-118 - - -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FTSZ_1	PS01134	FtsZ protein signature 1.	FTSZ_STAAM	44-78	1	- B:44-78 - -
2	FTSZ_2	PS01135	FtsZ protein signature 2.	FTSZ_STAAM	97-118	1	- B:97-118 - -

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FTSZ_1	PS01134	FtsZ protein signature 1.	FTSZ_STAAM	44-78	1	- - C:44-78 -
2	FTSZ_2	PS01135	FtsZ protein signature 2.	FTSZ_STAAM	97-118	1	- - C:97-118 -

Biological Unit 4 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FTSZ_1	PS01134	FtsZ protein signature 1.	FTSZ_STAAM	44-78	1	- - - D:44-78
2	FTSZ_2	PS01135	FtsZ protein signature 2.	FTSZ_STAAM	97-118	1	- - - D:97-118

(no "Exon" information available for 3VPA)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:289
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:304
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
           FTSZ_STAAM    12 ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vpaa1 A:12-208 Cel      l-division protein FtsZ                                                                                                                                                    d3vpaa2 A:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhhh------.eeeeee..hhhhhhh...eeee.hhhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhh...eeeeee.....---------.hhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.........hhhhh....eeeeeeeee...hhhhhhhhhhh.hhhhhhhhhhh.eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.......eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------FTSZ_1  PDB: A:44-78 UniProt: 44-78------------------FTSZ_2  PDB: A:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vpa A  12 ATLKVIGVGGGGNNAVNRMI------VEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFS---------AAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
                                    21        31      | 41        51        61        71        81        91       101       111       121       131     |   -     | 151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
                                              31     38                                                                                                137       147

Chain B from PDB  Type:PROTEIN  Length:280
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:304
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
           FTSZ_STAAM    12 ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vpab1 B:12-208 Ce      ll-division pro   tein FtsZ                                                                                                                                                 d3vpab2 B:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhh------..eeeeee..hhhhh---..eeee......------.hhhhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhh....eeeeee.....---------.hhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.....hhhhhhhhh....eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhh.eeeeeeee....hhhhhhhhhhhhhh......eeeeeeee.hhhh..eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------FTSZ_1  PDB: B:44-78 UniProt: 44-78------------------FTSZ_2  PDB: B:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vpa B  12 ATLKVIGVGGGGNNAVNRM------NVEFIAINTDGQALN---AESKIQIGEKLT------ANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFS---------AAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
                                    21        |-     |  41        51   |    61    |    - |      81        91       101       111       121       131     |   -     | 151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
                                             30     37            51  55         66     73                                                             137       147

Chain C from PDB  Type:PROTEIN  Length:300
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:304
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
           FTSZ_STAAM    12 ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vpac1 C:12-208 Cell    -division protein FtsZ                                                                                                                                                      d3vpac2 C:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhhhh----..eeeeee.hhhhhhh....eeee.hhhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhh..eeeeee......hhhhhhhhhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhh...eeeeeeeee...hhhhhhhhhhh.hhhhhhhhhh..eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.......eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------FTSZ_1  PDB: C:44-78 UniProt: 44-78------------------FTSZ_2  PDB: C:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vpa C  12 ATLKVIGVGGGGNNAVNRMID----NVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
                                    21        31|    |  41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
                                               32   37

Chain D from PDB  Type:PROTEIN  Length:295
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:305
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310     
           FTSZ_STAAM    11 LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vpad1 D:11-208 Cell-di  vision protein FtsZ                                                                                                                                                         d3vpad2 D:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeehhhhhhhhhhhhhhh--..eeeeee.hhhhhhh....eeee.hhhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhh..eeeeee....--------.hhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee......hhhhhhh......eeeeeeeee...hhhhhhhhhhh.hhhhhhhhhhh.eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.......eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------FTSZ_1  PDB: D:44-78 UniProt: 44-78------------------FTSZ_2  PDB: D:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vpa D  11 MATLKVIGVGGGGNNAVNRMIDHG--NVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPF--------TQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
                                    20        30   |  | 40        50        60        70        80        90       100       110       120       130     |   -    |  150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310     
                                                  34 37                                                                                                136      145

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Bacillus chorismate mutase-like (324)

Superfamily: Tubulin C-terminal domain-like (76)

Family: Tubulin, C-terminal domain (69)

Protein domain: Cell-division protein FtsZ (32)

Staphylococcus aureus [TaxId: 158878] (6)

1a	d3vpaa2	A:209-315
1b	d3vpab2	B:209-315
1c	d3vpac2	C:209-315
1d	d3vpad2	D:209-315

Class: Alpha and beta proteins (a/b) (23833)

Fold: Tubulin nucleotide-binding domain-like (75)

Superfamily: Tubulin nucleotide-binding domain-like (75)

Family: Tubulin, GTPase domain (69)

Protein domain: Cell-division protein FtsZ (32)

Staphylococcus aureus [TaxId: 158878] (6)

2a	d3vpaa1	A:12-208
2b	d3vpab1	B:12-208
2c	d3vpac1	C:12-208
2d	d3vpad1	D:11-208

(no "CATH Domain" information available for 3VPA)

(no "Pfam Domain" information available for 3VPA)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (FTSZ_STAAM | P0A029)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0043093	FtsZ-dependent cytokinesis	A cytokinesis process that involves a set of conserved proteins including FtsZ, and results in the formation of two similarly sized and shaped cells.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0051258	protein polymerization	The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
cellular component
	GO:0032153	cell division site	The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3vpa)

	Sites
(no "Sites" information available for 3vpa)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3vpa)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3vpa
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FTSZ_STAAM \| P0A029
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FTSZ_STAAM \| P0A029
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	FTSZ_STAAM \| P0A029	:	3vo8 3vo9 3voa 3vob 3wgj 3wgk 3wgl 3wgm 3wgn

(no "Related Entries Specified in the PDB File" available for 3VPA)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File