Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STAPHYLOCOCCUS AUREUS FTSZ APO-FORM (SEMET)
 
Authors :  T. Matsui, J. Yamane, N. Mogi, M. Yao, I. Tanaka
Date :  20 Jan 12  (Deposition) - 29 Aug 12  (Release) - 14 Aug 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.71
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Ftsz, Gtp-Binding, Tubulin Homolog, Polymerization, Gtpase, Cell Division, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Matsui, J. Yamane, N. Mogi, H. Yamaguchi, H. Takemoto, M. Yao, I. Tanaka
Structural Reorganization Of The Bacterial Cell-Division Protein Ftsz From Staphylococcus Aureus
Acta Crystallogr. , Sect. D V. 68 1175 2012
PubMed-ID: 22948918  |  Reference-DOI: 10.1107/S0907444912022640

(-) Compounds

Molecule 1 - CELL DIVISION PROTEIN FTSZ
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 12-316
    GeneFTSZ
    Organism ScientificSTAPHYLOCOCCUS AUREUS
    Organism Taxid158878
    StrainMU50

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 44)

Asymmetric Unit (1, 44)
No.NameCountTypeFull Name
1MSE44Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3VO9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3VO9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3VO9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3VO9)

(-) PROSITE Motifs  (2, 8)

Asymmetric Unit (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FTSZ_1PS01134 FtsZ protein signature 1.FTSZ_STAAM44-78
 
 
 
  4A:44-78
B:44-78
C:44-78
D:44-78
2FTSZ_2PS01135 FtsZ protein signature 2.FTSZ_STAAM97-118
 
 
 
  4A:97-118
B:97-118
C:97-118
D:97-118
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FTSZ_1PS01134 FtsZ protein signature 1.FTSZ_STAAM44-78
 
 
 
  1A:44-78
-
-
-
2FTSZ_2PS01135 FtsZ protein signature 2.FTSZ_STAAM97-118
 
 
 
  1A:97-118
-
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FTSZ_1PS01134 FtsZ protein signature 1.FTSZ_STAAM44-78
 
 
 
  1-
B:44-78
-
-
2FTSZ_2PS01135 FtsZ protein signature 2.FTSZ_STAAM97-118
 
 
 
  1-
B:97-118
-
-
Biological Unit 3 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FTSZ_1PS01134 FtsZ protein signature 1.FTSZ_STAAM44-78
 
 
 
  1-
-
C:44-78
-
2FTSZ_2PS01135 FtsZ protein signature 2.FTSZ_STAAM97-118
 
 
 
  1-
-
C:97-118
-
Biological Unit 4 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FTSZ_1PS01134 FtsZ protein signature 1.FTSZ_STAAM44-78
 
 
 
  1-
-
-
D:44-78
2FTSZ_2PS01135 FtsZ protein signature 2.FTSZ_STAAM97-118
 
 
 
  1-
-
-
D:97-118

(-) Exons   (0, 0)

(no "Exon" information available for 3VO9)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:295
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:304
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
           FTSZ_STAAM    12 ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vo9a1 A:12-208 Cell    -division protein FtsZ                                                                                                                                                      d3vo9a2 A:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhhhh----..eeeeee...hhhhh....eeee.hhhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhh.eeeeee.......-----.hhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.......hhhhhh......eeeeeeeeee..hhhhhhhhhhh.hhhhhhhhhhh.eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.hhhh.eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------FTSZ_1  PDB: A:44-78 UniProt: 44-78------------------FTSZ_2  PDB: A:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vo9 A  12 ATLKVIGVGGGGNNAVNRmID----NVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADmVFVTSGmGGGTGTGAAPVVAKIAKEmGALTVGVVTRPFSFE-----TQAAAGVEAmKAAVDTLIVIPNDRLLDIVDKSTPmmEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTImSNQGSALmGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLmNITGGESLSLFEAQEAADIVQDAADEDVNmIFGTVINPELQDEIVVTVIATGF 315
                                    21        31|    |  41        51        61        71        81        91      |101   |   111       121  |    131       | -   |   151  |    161       171       181       191       201       211      |221    |  231       241       251       261|      271       281       291|      301       311    
                                             30-MSE 37                                                           98-MSE  |                124-MSE        139   145      154-MSE                  179-MSE                                218-MSE 226-MSE                             262-MSE                       292-MSE                   
                                               32                                                                      105-MSE                                                                    180-MSE                                                                                                                                   

Chain B from PDB  Type:PROTEIN  Length:292
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:304
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
           FTSZ_STAAM    12 ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vo9b1 B:12-208 Cell    -division protein FtsZ                                                                                                                                                      d3vo9b2 B:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhhh.----.eeeeeee.hhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhh..eeeeee....--------.hhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.....hhhhhhh......eeeeeeeee...hhhhhhhhhh..hhhhhhhhhhh.eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.hhhh..eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------FTSZ_1  PDB: B:44-78 UniProt: 44-78------------------FTSZ_2  PDB: B:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vo9 B  12 ATLKVIGVGGGGNNAVNRmID----NVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADmVFVTSGmGGGTGTGAAPVVAKIAKEmGALTVGVVTRPF--------TQAAAGVEAmKAAVDTLIVIPNDRLLDIVDKSTPmmEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTImSNQGSALmGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLmNITGGESLSLFEAQEAADIVQDAADEDVNmIFGTVINPELQDEIVVTVIATGF 315
                                    21        31|    |  41        51        61        71        81        91      |101   |   111       121  |    131    |    -   |   151  |    161       171       181       191       201       211      |221    |  231       241       251       261|      271       281       291|      301       311    
                                             30-MSE 37                                                           98-MSE  |                124-MSE     136      145      154-MSE                  179-MSE                                218-MSE 226-MSE                             262-MSE                       292-MSE                   
                                               32                                                                      105-MSE                                                                    180-MSE                                                                                                                                   

Chain C from PDB  Type:PROTEIN  Length:301
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:304
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311    
           FTSZ_STAAM    12 ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vo9c1 C:12-208 Cell   -division protein FtsZ                                                                                                                                                       d3vo9c2 C:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhhhh---...eeeeee.hhhhhhh....eeee.hhhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhh..eeeeee......hhhhhhhhhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee......hhhhh........eeeeeeeee...hhhhhhhhhhh.hhhhhhhh....eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.hhhh..eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------FTSZ_1  PDB: C:44-78 UniProt: 44-78------------------FTSZ_2  PDB: C:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vo9 C  12 ATLKVIGVGGGGNNAVNRmID---NNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADmVFVTSGmGGGTGTGAAPVVAKIAKEmGALTVGVVTRPFSFEGRKRQTQAAAGVEAmKAAVDTLIVIPNDRLLDIVDKSTPmmEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTImSNQGSALmGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLmNITGGESLSLFEAQEAADIVQDAADEDVNmIFGTVINPELQDEIVVTVIATGF 315
                                    21        31|   |   41        51        61        71        81        91      |101   |   111       121  |    131       141       151  |    161       171       181       191       201       211      |221    |  231       241       251       261|      271       281       291|      301       311    
                                             30-MSE36                                                            98-MSE  |                124-MSE                       154-MSE                  179-MSE                                218-MSE 226-MSE                             262-MSE                       292-MSE                   
                                               32                                                                      105-MSE                                                                    180-MSE                                                                                                                                   

Chain D from PDB  Type:PROTEIN  Length:287
 aligned with FTSZ_STAAM | P0A029 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:303
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312   
           FTSZ_STAAM    13 TLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF 315
               SCOP domains d3vo9d1 D:13-208 Cell    -division protein FtsZ                                                                                                                                                     d3vo9d2 D:209-315 Cell-division protein FtsZ                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeehhhhhhhhhhhhh.----.eeeeee.hhhhhhh....eeee........----.hhhhhhhhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhhh..eeeeee....--------.hhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee......hhhhhhh......eeeeeeeee....hhhhhhhhhh.hhhhhhhh....eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.hhhh..eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------FTSZ_1  PDB: D:44-78 UniProt: 44-78------------------FTSZ_2  PDB: D:97-118 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vo9 D  13 TLKVIGVGGGGNNAVNRmIDH----VEFIAINTDGQALNLSKAESKIQIGEKLTRG----ANPEIGKKAAEESREQIEDAIQGADmVFVTSGmGGGTGTGAAPVVAKIAKEmGALTVGVVTRPF--------TQAAAGVEAmKAAVDTLIVIPNDRLLDIVDKSTPmmEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTImSNQGSALmGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLmNITGGESLSLFEAQEAADIVQDAADEDVNmIFGTVINPELQDEIVVTVIATGF 315
                                    22       |32|    |  42        52        62     |   -|       82        92     | 102  |    112       122 |     132   |     -  |    152 |     162       172      |182       192       202       212     | 222   |   232       242       252       262       272       282       292       302       312   
                                            30-MSE  38                            68   73                       98-MSE  |                124-MSE     136      145      154-MSE                  179-MSE                                218-MSE 226-MSE                             262-MSE                       292-MSE                   
                                                                                                                      105-MSE                                                                    180-MSE                                                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VO9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VO9)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (FTSZ_STAAM | P0A029)
molecular function
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0043093    FtsZ-dependent cytokinesis    A cytokinesis process that involves a set of conserved proteins including FtsZ, and results in the formation of two similarly sized and shaped cells.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
cellular component
    GO:0032153    cell division site    The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3vo9)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3vo9)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vo9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FTSZ_STAAM | P0A029
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FTSZ_STAAM | P0A029
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FTSZ_STAAM | P0A0293vo8 3voa 3vob 3vpa 3wgj 3wgk 3wgl 3wgm 3wgn

(-) Related Entries Specified in the PDB File

3vo8 3voa 3vob