3TKR - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkra_ A: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhh....................hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: A:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: A:83-122                ----------------------------------------Exon 1.7  PDB: A:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: A:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: A:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr A  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain B from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkrb_ B: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhhh....................hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: B:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: B:83-122                ----------------------------------------Exon 1.7  PDB: B:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: B:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: B:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr B  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain C from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkrc_ C: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhhh...................hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: C:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: C:83-122                ----------------------------------------Exon 1.7  PDB: C:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: C:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: C:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr C  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain D from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkrd_ D: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhhh...................hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: D:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: D:83-122                ----------------------------------------Exon 1.7  PDB: D:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: D:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: D:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr D  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain E from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkre_ E: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhhh....................hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: E:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: E:83-122                ----------------------------------------Exon 1.7  PDB: E:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: E:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: E:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr E  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain F from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkrf_ F: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhh....................hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: F:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: F:83-122                ----------------------------------------Exon 1.7  PDB: F:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: F:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: F:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr F  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain G from PDB  Type:PROTEIN  Length:195
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:195
                                    86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266     
          PRDX4_HUMAN    77 SKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkrg_ G: automated matches                                                                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhhh....................hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --THIOREDOXIN_2  PDB: G:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a --------------------------------------Exon 1.5a  PDB: G:83-122                ----------------------------------------Exon 1.7  PDB: G:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.4  PDB: G:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: G:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr G  40 SKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229

Chain H from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkrh_ H: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhhh....................hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: H:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: H:83-122                ----------------------------------------Exon 1.7  PDB: H:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: H:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: H:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr H  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain I from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkri_ I: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhhh...................hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: I:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: I:83-122                ----------------------------------------Exon 1.7  PDB: I:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: I:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: I:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr I  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain J from PDB  Type:PROTEIN  Length:197
 aligned with PRDX4_HUMAN | Q13162 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:197
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          PRDX4_HUMAN    75 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271
               SCOP domains d3tkrj_ J: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeee.hhhh..eeeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.hhhhh........eee...hhhhhhh...........eeeeee.....eeeeeee......hhhhhhhhhhhhhhhhhh....................hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----THIOREDOXIN_2  PDB: J:42-200 UniProt: 79-237                                                                                                                   ---------------------------------- PROSITE
           Transcript 1 (1) 1.2a   --------------------------------------Exon 1.5a  PDB: J:83-122                ----------------------------------------Exon 1.7  PDB: J:163-207 UniProt: 200-244    -----------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.4  PDB: J:44-83 UniProt: 81-120  --------------------------------------Exon 1.6b  PDB: J:122-163 UniProt: 159-200-------------------------------------------Exon 1.8    ---------------- Transcript 1 (2)
                 3tkr J  38 HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 234
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H,I,J (PRDX4_HUMAN | Q13162)

molecular function
	GO:0016209	antioxidant activity	Inhibition of the reactions brought about by dioxygen (O2) or peroxides. Usually the antioxidant is effective because it can itself be more easily oxidized than the substance protected. The term is often applied to components that can trap free radicals, thereby breaking the chain reaction that normally leads to extensive biological damage.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0004601	peroxidase activity	Catalysis of the reaction: donor + hydrogen peroxide = oxidized donor + 2 H2O.
	GO:0051920	peroxiredoxin activity	Catalysis of the reaction: 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0008379	thioredoxin peroxidase activity	Catalysis of the reaction: thioredoxin + hydrogen peroxide = thioredoxin disulfide + H2O.
biological process
	GO:0019471	4-hydroxyproline metabolic process	The chemical reactions and pathways involving 4-hydroxyproline, C5H9NO3, a derivative of the amino acid proline. The presence of hydroxyproline is essential to produce stable triple helical tropocollagen, hence the problems caused by ascorbate deficiency in scurvy. This unusual amino acid is also present in considerable amounts in the major glycoprotein of primary plant cell walls.
	GO:0007252	I-kappaB phosphorylation	The process of introducing a phosphate group into an inhibitor of kappa B (I-kappaB) protein. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing bound NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription.
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0098869	cellular oxidant detoxification	Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:2000255	negative regulation of male germ cell proliferation	Any process that stops, prevents or reduces the frequency, rate or extent of male germ cell proliferation.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0022417	protein maturation by protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that results in the attainment of the full functional capacity of a protein.
	GO:0072593	reactive oxygen species metabolic process	The chemical reactions and pathways involving a reactive oxygen species, any molecules or ions formed by the incomplete one-electron reduction of oxygen. They contribute to the microbicidal activity of phagocytes, regulation of signal transduction and gene expression, and the oxidative damage to biopolymers.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005790	smooth endoplasmic reticulum	The smooth endoplasmic reticulum (smooth ER or SER) has no ribosomes attached to it. The smooth ER is the recipient of the proteins synthesized in the rough ER. Those proteins to be exported are passed to the Golgi complex, the resident proteins are returned to the rough ER and the lysosomal proteins after phosphorylation of their mannose residues are passed to the lysosomes. Glycosylation of the glycoproteins also continues. The smooth ER is the site of synthesis of lipids, including the phospholipids. The membranes of the smooth ER also contain enzymes that catalyze a series of reactions to detoxify both lipid-soluble drugs and harmful products of metabolism. Large quantities of certain compounds such as phenobarbital cause an increase in the amount of the smooth ER.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 10)

Exons (7, 70)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 10)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (27, 27)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File