|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3P4H) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3P4H) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3P4H) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3P4H) |
Exons (0, 0)| (no "Exon" information available for 3P4H) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:118 aligned with B1L4V6_KORCO | B1L4V6 from UniProtKB/TrEMBL Length:117 Alignment length:118 1 | 9 19 29 39 49 59 69 79 89 99 109 B1L4V6_KORCO - -MPRFVVQEHHARRLHWDLRLEMDNVLKSWALPKGVPEKRGVKRLAIETEDHDLSYIDFEGRIPEGMYGAGEVKIWDSGEYELLERTENKIKFLAKGRKMNGEYVLIKTKVGWLLMKA 117 SCOP domains ---------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------LigD_N-3p4hA01 A:7-107 ---------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript 3p4h A 0 SMPRFVVQEHHARRLHWDLRLEMDNVLKSWALPKGVPEKRGVKRLAIETEDHDLSYIDFEGRIPEGMYGAGEVKIWDSGEYELLERTENKIKFLAKGRKMNGEYVLIKTKVGWLLMKA 117 9 19 29 39 49 59 69 79 89 99 109
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3P4H) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3P4H) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (B1L4V6_KORCO | B1L4V6)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|