|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3P43) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3P43) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3P43) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3P43) |
Exons (0, 0)| (no "Exon" information available for 3P43) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:124 aligned with Q46AP6_METBF | Q46AP6 from UniProtKB/TrEMBL Length:151 Alignment length:125 36 46 56 66 76 86 96 106 116 126 136 146 Q46AP6_METBF 27 DKPIFVVQRHDARKLHYDFRLEMDGVLKSWAVPKEPPKDAGTRRLAIETEDHPLAYADFEGEIPAGEYGAGKVEIWDRGTFELLKREEREIVVSLEGKELKGIYVLIRTKYGKGEKGWLFFKKAS 151 SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------LigD_N-3p43A01 A:34-134 ----------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 3p43 A 27 DKPIFVVQRHDARKLHYDFRLEMDGVLKSWAVPKEPPKDAGTRRLAIETEDHPLAYADFEGEIPAGEYGAGKVEIWDRGTFELLKREEREIVVSLEGKELKGIYVLIRTKYG-GEKGWLFFKKAS 151 36 46 56 66 76 86 96 106 116 126 136 | | 146 138 | 140
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3P43) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3P43) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q46AP6_METBF | Q46AP6)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|